SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012005 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012005
Domain Number 1 Region: 471-760
Classification Level Classification E-value
Superfamily Folate-binding domain 2.51e-84
Family Aminomethyltransferase folate-binding domain 0.0000351
Further Details:      
 
Domain Number 2 Region: 44-258,369-431
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.41e-59
Family FAD-linked reductases, N-terminal domain 0.00038
Further Details:      
 
Domain Number 3 Region: 258-368
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.84e-28
Family L-aminoacid/polyamine oxidase 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000012005
Domain Number - Region: 762-802
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.085
Family Aminomethyltransferase beta-barrel domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012005   Gene: ENSOCUG00000013960   Transcript: ENSOCUT00000013965
Sequence length 805
Comment pep:known_by_projection scaffold:OryCun2.0:GL019088:58121:126468:1 gene:ENSOCUG00000013960 transcript:ENSOCUT00000013965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRGLRGLRGLRGLPLCASPRRLRSGSSSQGEEKPDTTWKDRAEIVIIGGGCVGVSLAYH
LAKAGMRDVVLLEKSELTAGSTWHAAGLTTYFHPGINLKKIHYDSIKLYEKLEEETGQAV
GFHQPGSIRLATTPVRVDEFKYQMTRAGWHATEQYLIGPEKVQEMFPLLNVDKVLAGLYN
PGDGHIDPYSLTMALAAGARKYGALLKYPAPVTSLAPRSDGTWDVDTPQGSVRAKRLVNA
AGFWAREVGKMIGLEHPLIPVQHQYLVTSTIPEVKALKRELAVLRDLEGSYYVRQERDGL
LLGPYERQEKMRVQDSWVTDGVPPGFGKELFEADLDRITEHLEIAMEMIPVLKKADIVNV
VNGPITYTPDILPMVGPHQGVRNYWVAVGFGYGIIHAGGIGKYLSEWILQGEPPFDLIEL
DPNRYGRWTTPQYTEAKARESYGFNNVVGYPKEERFAGRPTQRVSGLYSILQPRCSMGFH
AGWEQPHWFYKPGQDTQYRPSFRRTNWFEPVGSEYEQVMQKVGVIDLSPFGKFHIKGRDS
VTLLDNLFANVVPKVGFTNISHMLTPRGRVYAELTVSHQAPGDFLLVTGSGSELHDLRWI
EEAAIRGGYEVEISNTTDELGVLGVAGPRARQVLQKLTSEDLSDGAFKFLQVKPLKVAHV
PVTAIRISYTGELGWELYHRREDSPALYEALMNAGQEEGIADFGTYALNVLRLEKAFRAW
GAEMNCDTNPLEAGLEPFVKLDKPADFIGKHALRQIKASGLKRRLVCLTLATDDVDPEGN
ESVWYEGKNKATVTRRCCSHRIHSV
Download sequence
Identical sequences G1T6G8
ENSOCUP00000012005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]