SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012063 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012063
Domain Number 1 Region: 87-185
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.07e-18
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012063   Gene: ENSOCUG00000014035   Transcript: ENSOCUT00000014033
Sequence length 203
Comment pep:known_by_projection chromosome:OryCun2.0:X:72791446:72938254:1 gene:ENSOCUG00000014035 transcript:ENSOCUT00000014033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRSGGGKGEKKKGKRKREEQRQTPEKAVAFVPPHGTVPGEKTETEEETGAWKCGWEAKC
SPIGSVPAVAAAAPLPFSGPKQPQVAVSRMVIRVYIASSSGSTAIKKKQQDVLGFLEANK
IGFEEKDIAANEENRKWMRENVPENSRPATGYPLPPQIFNESQYRGDYDAFFEARENNAV
YAFLGLTAPPGSKEAEAQAKQEA
Download sequence
Identical sequences G1T6L5
ENSOCUP00000012063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]