SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012713 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012713
Domain Number 1 Region: 544-576,714-788
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000235
Family Anti-sigma factor antagonist SpoIIaa 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000012713
Domain Number - Region: 161-294
Classification Level Classification E-value
Superfamily Thiolase-like 0.0209
Family Thiolase-related 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012713   Gene: ENSOCUG00000014776   Transcript: ENSOCUT00000014781
Sequence length 972
Comment pep:known_by_projection chromosome:OryCun2.0:12:25947691:26029206:-1 gene:ENSOCUG00000014776 transcript:ENSOCUT00000014781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPERSTQSFNYKYRQNSFSYDVKRDIYNEENFEQEHRKRGLSSGNVDIDITTFRHHVRC
RCSWPRFLRCTFTIFPFLQWMCLYRFKDWLLGDLLAGLSVGLVQVPQGLTFTLLARQLIP
PLNIAYAAFCSSVIYVIFGSCHQMSIGSFYLVSALMINVLKESPFNDGHLIIGSFIKDDF
SAPSFFIGYNKSLSMVAATTFLTGIIQLILGLLGFGFVATYLPEAAVSAYLAATALHIML
SQLTCIFGIMISFHAGPIAFFYNIINYCVALPKANSTSILLFLTAVVALRINKCVRISFN
RYPIEFPMELLLILGFSMIANNISMATENSRTLTEMIPYSFLFPVTPDFSDLHRVIYQAI
SLSLVSSFMLIFLGKKISSPHNYRVNSNQDLIAIGFCNVVSSFFRSFVFTGAIARTIIQD
KCGGRQQFASLVGAGLMLLLMVKAGHFFSELPNAVLAGIILSNVLPYLEAIYSLPTLWRQ
DQYDCILWLVTFSSAIFLGLDFGLLVSLVFAFFIITVRSHRTKVLLLGQIPNTNIYRSIN
DYREIVSIPGVKIFQCCNSITFVNIYHLRRRLLKEVDMVRVPLKEEEIFSLFNQSDMDAQ
ENKIFRCSCNCDEVEPPPRIVYTERFESKQDPDTSSVNLVRCSRLDSMITSQSASEDQMP
YTTSSISQRTQGQNYEDVEKAWSPNYPQRNSLQPPADQSQQRSRPFTPFSDPYLQPSTHT
IILDFSMVHFVDARALVILRQMCNAFQNANILMLIAGCHSSVVRAFEKNDFFDAGITKAQ
LFLSLHDAVLFALSRKVAEPSELSLDESETVIRETYSETDKNDKPGSKISGSFLESPKIS
SPGFFNSPEPIEEELSEFDLELEPVLQSEQGTRLGHGLDLDQEMEPESEAEPKTELETQP
EPKPETENEAEMDREPASTSRPRIYSQPRRHYQPVYHPVVPKSQSQNRSWSTEKRRSQKD
SYTSEGHSKEMN
Download sequence
Identical sequences G1T841
XP_008261053.1.1745 ENSOCUP00000012713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]