SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000012735 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000012735
Domain Number 1 Region: 7-198
Classification Level Classification E-value
Superfamily Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 6.15e-55
Family Pyrrolidone carboxyl peptidase (pyroglutamate aminopeptidase) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000012735   Gene: ENSOCUG00000014817   Transcript: ENSOCUT00000014813
Sequence length 239
Comment pep:known_by_projection scaffold:OryCun2.0:GL018753:1668247:1680251:-1 gene:ENSOCUG00000014817 transcript:ENSOCUT00000014813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPQAGCVVVTGFGPFRQHLVNPSWEAVQELSKLGLGGDTEVELRTLQLPVDYRAARQEV
TRIWEDLRPQLVVHVGMDASTKVIILEQCGKNRGYRDADIRGFRPEGGVCVAGGPEVIAS
VVSMRAVCRRLAVEDVEMAFSRDAGRYVCDYTYYLSLHLGSGHAALVHVPPRSRGLPASL
LAKALQVIIQALLEESAKARAQSLVGGKPAHVDASQREPAEKMKSFSPGESSPVHREAS
Download sequence
Identical sequences G1T859
ENSOCUP00000012735 XP_008247013.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]