SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000013349 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000013349
Domain Number 1 Region: 2-141
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.61e-20
Family Pentraxin (pentaxin) 0.085
Further Details:      
 
Domain Number 2 Region: 389-468,501-519
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000000000314
Family Reprolysin-like 0.096
Further Details:      
 
Domain Number 3 Region: 1227-1301
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000181
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 4 Region: 242-320,423-450
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000114
Family Zinc protease 0.079
Further Details:      
 
Domain Number 5 Region: 1293-1350
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000131
Family Complement control module/SCR domain 0.0065
Further Details:      
 
Domain Number 6 Region: 1171-1233
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000181
Family Complement control module/SCR domain 0.0066
Further Details:      
 
Domain Number 7 Region: 748-810
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000481
Family Fibronectin type III 0.007
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000013349
Domain Number - Region: 1431-1461
Classification Level Classification E-value
Superfamily Notch domain 0.017
Family Notch domain 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000013349   Gene: ENSOCUG00000015524   Transcript: ENSOCUT00000015535
Sequence length 1494
Comment pep:known_by_projection chromosome:OryCun2.0:13:3634082:3910319:1 gene:ENSOCUG00000015524 transcript:ENSOCUT00000015535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQNNPAIIAGVFDNCSHITSDKGWALGIRSGRDKGRRDARFFFSLRTDRMQKATVVTGHS
RYQPDKWTHVAATYDGRRMALYVDGTRVAGSAGQTGPLNSPFMASCRALLLGGDSSEDRH
HFRGHLGTLVLWSSALPQSHLQHGPQHPSGVEEPTTLILTASFDLLKEQWVPFRDGAYPR
LEVLQGAEPEPEILSPLQPPLCGQTACDNVELISQYNQHRPLRGEKAIRYQVVNICDDEG
LNPTVSEEQILRQHKELNEAFNRYNISWQLSVHQVRNSTLRHRVVLVNCEPSKIGNDHCD
PECEHPLTGYDGGDCRLQGRCYSWHRRDGLCHAECNNMLNDFDDGDCCDPEVADVRKTCF
DPDSPKRAYMSVKELKETLQLNSTHFLNVYFATSVREDLAGAATWPWDKEAVSYLGGVVL
NPSYYGMPGHTNIMIHEVGHVLGLYHVFKGVSERESCDDPCREMVPSMETGDLCADTAPT
PKSKLCRDPEPTNDTCGFTHFPGAPFRNYMSYTDDDCTDSFTPNQVARMHCYLDLVYQQW
SQSRKPTPIPIPPMVIGQTHKSLTIHWLPPISGDVYDRTPGSVCGSCSEDGTFRQYVHTA
SSRRVCDSSGYWTPDEAVGPPDVDQPCEPSLQAWSPELHLYHMNMTVPCPAEGCSLELRF
QHPVHADTLTLWVTYLSMGSSQALFDTEILLEQQGSVHLGPLDTFCDTPLTIKLHVEGKV
SGVKVYTFDERMEIDAALLTSRPQSPLCSGCRPVRYRVLREPPFTSGSSVVVTHPRRKFT
DMEVTPGQLYQYQVQAEAGAELGEASPPLVHIHGAPYCGNGKVEKSLGEECDDGDLLNGD
GCSRVCELEQGFNCVGEPSLCYMYEGDGLCESFEKETSIFDCGLYTPTGYSDQWATQAYS
PHEDKKKCPVSLVTGEPHSMICTSYHPDLPKHRPLTGWFPCVSNGNRPQDEGRKKAEGSL
EKEDEVWLQVCFSRPGVATAIFIFLASDGLAPGERRQPTVTVYLTDISGSNHSLGTYELS
CQQNPVVINVTHHTTALLHHTASVLLNFSSPLVGISAVALRTPSHISFSAPQSCIPANRG
QTHQGQSCVYRPCGEQGSCAPLLLDHADRVNCSSHGPGHMKCAIVCQRGFALQASSGQYL
RPIQKETLLTCSSGHWDMDVSCMPFDCGIPDPSLVNHATFSCPEGTDFLKRCSISCVAPA
KLQGLSPWLTCLEDGLWSLPEVYCKLECDAPPVILNADLLLPHCLRGQHDVGTVCRYECK
PGYYALQSVETKARSKFLKIQCLEGGVWEQGSCIPVVCEPPSPVFEGMYECTNGFKLDSQ
CVLNCNQEAERSPILCTTEGLWTQEFKLCENLGGECPPPPSELNLVEYKCEQGYGIGAEC
SPLCMIPPSDPVLLPENITTDTLEHWMQPVRVQSIVCTGRRRWHPDPLLIHCIQSCEPFQ
ADGWCDTINNRAYCHYDGGDCCSSTLSSKKVIPFAADCDQDECTCRDPKAEENQ
Download sequence
Identical sequences G1T9N4
ENSOCUP00000013349 ENSOCUP00000025431 9986.ENSOCUP00000013349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]