SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014078 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014078
Domain Number 1 Region: 191-303
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-17
Family Spermadhesin, CUB domain 0.0043
Further Details:      
 
Domain Number 2 Region: 398-435
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000275
Family LDL receptor-like module 0.00081
Further Details:      
 
Domain Number 3 Region: 139-176
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000759
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 4 Region: 34-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000772
Family Spermadhesin, CUB domain 0.0035
Further Details:      
 
Domain Number 5 Region: 328-353
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000785
Family LDL receptor-like module 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000014078
Domain Number - Region: 356-397
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00445
Family LDL receptor-like module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014078   Gene: ENSOCUG00000016380   Transcript: ENSOCUT00000016379
Sequence length 713
Comment pep:known_by_projection chromosome:OryCun2.0:17:43103633:43108491:1 gene:ENSOCUG00000016380 transcript:ENSOCUT00000016379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPATFLLLLLGGALAHPDRILFPNPACEDPPALLLEVQGTLQRPLSRDSRGSPVNCTWL
ILGSKEQTVTVRFQKLHLACGSERLILHSPLQPLISLCEAPASPLQLPGGNVTITYSYAG
ARAPVGPGFLLSYSQDWLMCLQEEFQCLNHRCVPAAQRCDGVDACGDGSDEAGCSSDPFP
GLTPASAPTLPCNLTLEDFYGVFSSPGYSHLASVSHPQSCLWLLDPHDGRRLAVRFTALD
LGYGDAVHVYDGAGPPEAPRLLRSLTHLNNGKAVTVETLSGQAVVAYHTVAWSSGRGFNA
TYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEENCPGCPPGH
YPCGAAGTPSATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDG
QPDCADGSDEWDCSYALPRKVITAAIIGSLVCGLLLVIALGCTCKLYAIRTQEYSIFAPL
SRMEAEIVQQQAPPSYGQLIAQGAIPPVDDFPTENPNDNSVLGNLRSLLQILRQDMTPGG
ASGARRRQRGRSVRRLVRRLRRWGLLPRANPPARAPETRSQVASPAAPPEALDGSAGPAP
EGGAVGGQDGEQAPPLPVKAPLPAASTSPALPPAPEAPEPLPSGPLEPSLLSGVVQALRG
RFLPSLRPLGPTWPPPGPQAAVLAPEDEDDVLLVPLAEPGVWVVEAEDEPLLA
Download sequence
Identical sequences G1TBI2
9986.ENSOCUP00000014078 XP_002718107.1.1745 ENSOCUP00000014078 ENSOCUP00000014078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]