SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014145 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014145
Domain Number 1 Region: 1430-1618
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.07e-38
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 334-449
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000738
Family Growth factor receptor domain 0.0089
Further Details:      
 
Domain Number 3 Region: 132-174
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000625
Family EGF-type module 0.014
Further Details:      
 
Domain Number 4 Region: 782-906
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000769
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 5 Region: 13-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000803
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 6 Region: 211-335
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000942
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 7 Region: 49-88
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000025
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 8 Region: 623-661
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000644
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 441-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000447
Family EGF-type module 0.011
Further Details:      
 
Domain Number 10 Region: 533-659
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000154
Family Growth factor receptor domain 0.0045
Further Details:      
 
Domain Number 11 Region: 91-136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000157
Family EGF-type module 0.023
Further Details:      
 
Domain Number 12 Region: 1108-1139
Classification Level Classification E-value
Superfamily Notch domain 0.000000262
Family Notch domain 0.0024
Further Details:      
 
Domain Number 13 Region: 700-742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000304
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 14 Region: 902-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000401
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 750-789
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000464
Family EGF-type module 0.024
Further Details:      
 
Domain Number 16 Region: 664-704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000142
Family EGF-type module 0.017
Further Details:      
 
Domain Number 17 Region: 169-215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000023
Family EGF-type module 0.01
Further Details:      
 
Domain Number 18 Region: 1071-1101
Classification Level Classification E-value
Superfamily Notch domain 0.00000981
Family Notch domain 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000014145
Domain Number - Region: 989-1027
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000336
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 1030-1059
Classification Level Classification E-value
Superfamily Notch domain 0.00471
Family Notch domain 0.0035
Further Details:      
 
Domain Number - Region: 481-512
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00662
Family EGF-type module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014145   Gene: ENSOCUG00000016445   Transcript: ENSOCUT00000016455
Sequence length 1764
Comment pep:novel chromosome:OryCun2.0:12:20976805:20998353:-1 gene:ENSOCUG00000016445 transcript:ENSOCUT00000016455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGWTGEQCQLRDFCSANPCINGGVCLATYPQIQCRCPPGFQGHTCEHDINECFLDPGPC
PKGTSCHNTLGSFQCLCPAGREGPHCEFRAGPCPHRGCLNGGTCQLLPGADPPFHLCLCP
TGFTGPDCDVNPDDCVRHQCQNGGTCQDGLGSYTCLCPEAWTGWDCSADVDECEAQGPAR
CRNGGTCQNSAGSFHCVCVSGWGGTGCEENLDDCLAATCAPGSTCIDRVGSFSCLCPPGR
TGLLCHLEDMCLSQPCHGEAQCSTNPLTGSTLCLCQPGYSGPTCHQDLDECQMAQQGPSP
CEHGGSCLNTPGSFNCLCPPGYTGSRCEADHNECLSQPCHPGSTCLDLLATFHCLCPPGL
EGRLCEVETDECASAPCLNHADCHDLLNGFLCICPPGFTGAQCEEDIDECRSSPCAGGGR
CQDKPGAFHCECLPGFEGPRCETEVDECLSGPCSPGASSLDLPGGFSCLCPSGVTGQLCE
VPLCAPNLCQPKKKCQDQEDKAHCLCPDGSPGCAPAEDNCTCHHGHCQRSSCVCDVGWTG
PECEAELGGCVSAPCAHGGTCYPQASGYNCTCPAGYTGPTCSEEVTACHSGPCLNGGSCS
PSPGGYSCTCPASHTGPQCQTSTDHCVSAPCLNGGTCVSRPGTSFCLCAMGFQGPRCEGR
IRPSCADSPCRNQATCQDSPQGPRCLCPPGYTGGSCQTLVDLCAQKPCLHSSHCLQAGPS
FHCLCLQGWTGPLCNVPLSPCQRAALSQGTDVPSLCQNGGLCIDSGTSYFCHCQPGFQGS
LCQDNVNPCESRPCQHGATCVAQANGYLCQCAPGYSGQNCSKEPDACQSQPCHNQGTCTP
TPGGFHCACPPGFVGLRCEGDVDECLERPCHPTGTAACHSLANAFYCQCLPGHTGQWCEV
EIDPCQSQPCSHGGSCEATAGQPPGFTCHCPKGFEGPTCSHRAPPCGLHHCHHGGLCLPS
PKPGLPPLCACLNGYGDPDCLTPLAPQGCGPPSPCLHNGSCSESPGLGGPGFRCSCPPDS
PGPRCQRPGAKGCEGRGGDGACDAGCSGPGGNWDGGDCSLGVPDPWKGCPSHSRCWLLFR
DGQCHPQCDSEECLFDGYDCETPPTCTPAYDQFCRDHFHNGHCEKGCNTAECGWDGGDCR
PEDGDSEWGPSLALLVVLSPSALEQQLLALARVLSLSLRVGLWVKRDGDGRDMVFPYPGA
RAEEELGGTRDPSHQERAAPHPQPLGKETDTLGAGFVVVMGVDLSHCGPDHPASRCPWDP
GLLLRFLAALAAVGALEPLLPGPLLAAHPHAGTAPPASQLPWPVLCSPVAGVLLLVLGAL
LVLQLIRRRRREHGALWLPPGFTRRPRTQPAPRRRRPPLGEDSIGLETLKPEAEVEEDGV
VMCSGPEEGEEAEETAPAPKCQLWHLSGGCGVLPQAAMLTPPQESEMEAPDVDTCGPDGV
TPLMSAVCCGGVESKIFQGTWLGGPEPWESLLDGGSCPQAHTVGTGETPLHLAARFSRPT
TARRLLEAGANPNQPDRAGRTPLHAAVAADAREVCQLLLRSRQTAVDARTEDGTTPLMLA
ARLAVEDLVEELLAARADVGARDKWGKTALHWAAAVNNARAARSLLQAGADKDAQDNRDS
AQDEQSWPPLNSTPRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTEHLLDLVAEAQSRR
LEEQRATFRAPQNPPALAAPPSRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELL
ELLLRVQGGGRMEEQRSRPPTHTC
Download sequence
Identical sequences G1TBN7
ENSOCUP00000014145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]