SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014264 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014264
Domain Number 1 Region: 319-682
Classification Level Classification E-value
Superfamily SIS domain 4.45e-105
Family double-SIS domain 0.000000454
Further Details:      
 
Domain Number 2 Region: 2-209,250-294
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.56e-55
Family Class II glutamine amidotransferases 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014264   Gene: ENSOCUG00000016591   Transcript: ENSOCUT00000016594
Sequence length 682
Comment pep:known_by_projection scaffold:OryCun2.0:GL018730:1766836:1816632:-1 gene:ENSOCUG00000016591 transcript:ENSOCUT00000016594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCGIFAYMNYRVPRTRKEIFETLIKGLQRLEYRGYDSAGVAIDGNNHEVKERHIQLVKKR
GKVKALDEELYKQDSMDLKVEFETHFGIAHTRWATHGVPNAVNSHPQRSDKGNEFVVIHN
GIITNYKDLRKFLESKGYEFESETDTETIAKLIKYVFDNRETEDITFSTLVERVIQQLEG
AFALVFKSIHYPGEAVATRRGSPLLIGVRSKYKLSTEQIPILYRSCTIENAKSTCKARTR
RLDSSTCLHAVGDKAVEFFFASDASAIIEHTNRVIFLEDDDIAAVADGKLSIHRVKRSAS
DDPSRAIQTLQMELQQIMKGNFSAFMQKEIFEQPESVFNTMRGRVNFETNTVLLGGLKDH
LKEIRRCRRLIVIGCGTSYHAAVATRQVLEELTELPVMVELASDFLDRNTPVFRDDVCFF
ISQSGETADTLLALRYCKDRRALTVGVTNTVGSSISRETDCGVHINAGPEIGVASTKAYT
SQFISLVMFGLMMSEDRISLQSRRQEIIRGLRALPELIKEVLSLDEKIHDLALELYTQRS
LLVMGRGYNYATCLEGALKIKEITYMHSEGILAGELKHGPLALIDKQMPVIMLIMKDPCF
AKCQNALQQVTARQGRPIILCSRDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH
LAVLRGYDVDFPRNLAKSVTVE
Download sequence
Identical sequences G1TBY9
ENSOCUP00000014264 XP_008273224.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]