SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014592 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014592
Domain Number 1 Region: 192-433
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 6.36e-86
Family Eukaryotic proteases 0.00026
Further Details:      
 
Domain Number 2 Region: 100-199
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-16
Family Hepsin, N-terminal domain 0.05
Further Details:      
 
Domain Number 3 Region: 53-91
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000113
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014592   Gene: ENSOCUG00000016983   Transcript: ENSOCUT00000016984
Sequence length 437
Comment pep:known_by_projection scaffold:OryCun2.0:GL018782:178012:218576:1 gene:ENSOCUG00000016983 transcript:ENSOCUT00000016984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPASDQPLNGIDAAPLRKPRTSLENFKRVGVPIIAALLSLATIIILAVLIKVILDKYYF
LCGHPLRFIPLGQVCDGQANCAMGEDEEQCVKVFPERPSVAVRLSKDRSSLQVLNLATGN
WASVCFDSFSPALAKAACGKMGYSRTSNPTFRAVKIGPDQQLDVVEITQNNQELQVQNSS
RPCLSGSLVSLTCLACGQSPKAPRVVGGQQASVDSWPWQVSIQYKKQHVCGGSILDPHWI
LTAAHCFRKHLDVYSWKVRAGSEKVDDSPSLPVAKIFVSEYNSSYPKEKDIALVKLQFPL
TFSDTVRPICLPFFDEELPPATPLWVVGWGFTEEGGGKMSDTLLQASVQVIDHTRCNAED
AYQGEVTETMLCAGIPGGGVDTCQGDSGGPLMYHAGQWQVVGIVSWGHGCGGPSTPGVYT
KVAAYLDWIYNVRKSEL
Download sequence
Identical sequences G1TCR7
XP_008247645.1.1745 ENSOCUP00000014592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]