SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014764 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014764
Domain Number 1 Region: 540-585
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000432
Family TSP-1 type 1 repeat 0.00089
Further Details:      
 
Domain Number 2 Region: 90-130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000511
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 38-85
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000144
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000014764
Domain Number - Region: 493-531
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0389
Family EGF-type module 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014764   Gene: ENSOCUG00000017178   Transcript: ENSOCUT00000017181
Sequence length 585
Comment pep:known chromosome:OryCun2.0:13:109967539:110036311:-1 gene:ENSOCUG00000017178 transcript:ENSOCUT00000017181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVAAFFTLFLVTCQPAVTAQEKVNQRVNRAATPRAFDCQLSSWSEWTDCFPCQDTKYRH
RSLLQPNKFGGTICSGDIWDRASCYSPTACLRPAQCGQDFQCKETGRCLKRHLVCNGEND
CLDGSDEDNCEDIRATESDCAQYDPIPGSEKAALGYNILTQEEAQSVYDARYYGGRCETV
YNGEWRQLRYDPVCERLHHGEDDKYFRKPYNFLKYHFEARADTGISFELYVDGNDLFSKV
KNDKSHSAGVTISAGLTGSPLLGTVGVSGSEDASFLNKLSQYNEKKYNFMRIFTKVQTAH
FKMRRDDIVLDEGMLQALVELPEQYNYGMYSKFINDYGTHYITSGSMGGTYEYILVLNTE
KMESLGVTSEDISSCFGGFGEIQYEKGKINAQGILSGKHCKKSGSGDKEADKMGQAVKDI
ISRVRGGSSGWGGGLSQNGSATTYRFWGRSLKYNPVVIDFEMQPIHEVLLHTNLGHVEAK
RQNLRRALDQYLMEFNACRCGPCFNNGKPILEGTSCRCQCSLGLQGPACEQTEQQGAKAD
GHWSCWGSWSPCTAGTRERRRECNNPAPQNGGAPCPGWRVQTQAC
Download sequence
Identical sequences G1TD60
ENSOCUP00000014764 ENSOCUP00000014764 9986.ENSOCUP00000014764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]