SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014803 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014803
Domain Number 1 Region: 1146-1411
Classification Level Classification E-value
Superfamily YWTD domain 1.11e-51
Family YWTD domain 0.00000205
Further Details:      
 
Domain Number 2 Region: 416-678
Classification Level Classification E-value
Superfamily YWTD domain 2.88e-47
Family YWTD domain 0.00000506
Further Details:      
 
Domain Number 3 Region: 1766-2011
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-47
Family YWTD domain 0.0000149
Further Details:      
 
Domain Number 4 Region: 1461-1718
Classification Level Classification E-value
Superfamily YWTD domain 6.54e-43
Family YWTD domain 0.0000219
Further Details:      
 
Domain Number 5 Region: 2901-3156
Classification Level Classification E-value
Superfamily YWTD domain 7.32e-42
Family YWTD domain 0.0000196
Further Details:      
 
Domain Number 6 Region: 91-333
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-41
Family YWTD domain 0.0000876
Further Details:      
 
Domain Number 7 Region: 2075-2342
Classification Level Classification E-value
Superfamily YWTD domain 4.19e-32
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 8 Region: 3777-4055
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-30
Family YWTD domain 0.0000722
Further Details:      
 
Domain Number 9 Region: 2812-2893,3149-3210
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.42e-24
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 10 Region: 1049-1138,1412-1456
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000659
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 11 Region: 763-808
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000576
Family LDL receptor-like module 0.00076
Further Details:      
 
Domain Number 12 Region: 3681-3801,4047-4094
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 13 Region: 3643-3683
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000223
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 14 Region: 3517-3553
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00092
Further Details:      
 
Domain Number 15 Region: 807-846
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 16 Region: 728-767
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 17 Region: 2776-2817
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000484
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 18 Region: 3478-3515
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000537
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 19 Region: 3238-3282
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000759
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 20 Region: 851-889
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 21 Region: 890-928
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000851
Family LDL receptor-like module 0.00022
Further Details:      
 
Domain Number 22 Region: 2645-2681
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 23 Region: 3356-3396
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 24 Region: 938-974
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.00057
Further Details:      
 
Domain Number 25 Region: 2688-2722
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000236
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 26 Region: 3559-3602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 27 Region: 3438-3473
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 28 Region: 2566-2602
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 29 Region: 3201-3236
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000537
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 30 Region: 2472-2511
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 31 Region: 3321-3357
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000864
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 32 Region: 3399-3436
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 33 Region: 3280-3317
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 34 Region: 2431-2472
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 35 Region: 2724-2765
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 36 Region: 2605-2647
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 37 Region: 49-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000502
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 38 Region: 1720-1770
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000679
Family EGF-type module 0.015
Further Details:      
 
Domain Number 39 Region: 2396-2433
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000275
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 40 Region: 2525-2561
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000288
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 41 Region: 1020-1055
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000458
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 42 Region: 980-1017
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000825
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 43 Region: 4274-4314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000533
Family EGF-type module 0.04
Further Details:      
 
Domain Number 44 Region: 3606-3637
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000694
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 45 Region: 2030-2079
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000988
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 46 Region: 4174-4209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family EGF-type module 0.028
Further Details:      
 
Domain Number 47 Region: 4-81,347-402
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000471
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 48 Region: 684-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000758
Family EGF-type module 0.02
Further Details:      
 
Domain Number 49 Region: 4100-4136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000838
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000014803
Domain Number - Region: 4138-4172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000148
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 4211-4243
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0178
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014803   Gene: ENSOCUG00000017165   Transcript: ENSOCUT00000017230
Sequence length 4406
Comment pep:known_by_projection chromosome:OryCun2.0:7:78232673:79435066:-1 gene:ENSOCUG00000017165 transcript:ENSOCUT00000017230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELLSNCQQLNCQYKCAVMRNSTRCYCEDGFEVKEDGRGCKDQDECAAYGTCSQMCMNTHG
SYVCSCVEGYIMQPDNRSCKAKNEPTERPPMLLVANSETIEVFYLNGSKMATLSPANGNE
IHALDFIYNEDMICWIESRESSYQLKCIQITKTGRLTDEWTIHILQSFHNVQQMAIDWLT
RNLYFVDHVSDRIFVCNYNGSVCVTLIDLELHNPKAIAVDPIAGKLFFTDYGNIAKVERC
DMDGMNRTRIIDSKTEQPAALALDLVNKLVYWVDLYLDYVGVVDYQGKNRHTIIQGRQVR
HLYGITVFEDYLYAITSGNVNIIRINRFNGTDNHSLIKIESARGIRIYQKRTQPTVRSHA
CEVDPHGMPGGCSHICLLSSSYKTRTCRCRTGFNLGSDGRSCKRPKNELFLFYGKGRPGI
VRGMDLNTKIADEYMIPIENLVNPRALDFHAETNYIYFADTTSFLIGRQKIDGTERETIL
KDDLDNVEGIAVDWIGNNLYWTNDGHRKTINVARLEKASQSRKTLLEGEMSHPRGIVVDP
VNGWMYWTDWEEDEIDDSVGRIEKAWMDGFNRQIFVTSKMLWPNGLTLDFHSNTLYWCDA
YYDHIEKVFLNGTHRKIVYSGKELNHPFGLSHHGNYVFWTDYMNGSIFQLDLVTSEVTLL
RHERPPLFGLQIYDPRKQQGDNMCRVNNGGCSTLCLAIPAGRVCACADNQLLDENGTTCT
FNPGELLPHVCKAGEFRCKNRHCIQARWKCDGDDDCLDGSDEDAVNCFNHSCPDDQFQCQ
NNRCIPKRWLCDGANDCGSNEDESNQTCAARTCQVDQFSCGNGRCIPRAWLCDREDDCGD
QTDEMASCEFPTCEPLTQFICKSGRCISSKWHCDSDDDCGDGSDEVGCVHSCFENQFRCS
SGRCIPGHWACDGDNDCGDFSDETQINCTKEEIHSPAGCNGNEFQCHPDGNCIPDLWRCD
GEKDCEDGSDEKGCNGTIRLCDHKTKFSCRSTGRCINKAWICDGDIDCEDQSDEDDCDSF
LCGPPKYPCANDTSVCLQPEKLCNGKRDCPDGSDEGSLCDECSLNNGGCSNHCSVVPGKG
IVCSCPEGLQLNKDNKTCEIVDYCSNHLKCSQVCEQHKHTVKCSCYEGWRLDVDGESCTS
VDPFEAFIIFSIRHEIRRIDLHKRDYSLLVPGLRNTIALDFHFNQSLLYWTDVVEDRIYR
GKLSESGGVSAIEVVVEHGLATPEGLTVDWIAGNIYWIDSNLDQIEVAKLDGSLRTTLIA
GAMEHPRAIALDPRYGILFWTDWDANFPRIESASMSGAGRKTIYKDMKTGAWPNGLTVDH
FEKRIVWTDARSDAIYSALYDGTNMIEIIRGHEYLSHPFAVSLYGSEVYWTDWRTNTLSK
ANKWTGQNVSVIQKTSAQPFDLQIYHPSRQPQAPNPCAANDGKGPCSHMCLINYNRSAAC
ACPHLMKLSSDKKTCYEMKKFLLYARRSEIRGVDIDNPYFNFITAFTVPDIDDVTVIDFD
AYEERLYWTDIKTQTIKRAFINGTGLETVISRDIQSIRGLAVDWVSRNLYWISSEFDETQ
INVARLDGSLKTSIIHGIDKPQCLAAHPVRGKLYWTDGNTINMANMDGSNSKILFQNQKE
PVGLSIDYVENKLYWISSGNGTINRCNLDGGNLEVIESMKEELTKATALTIMDKKLWWAD
QNLAQLGTCNKRDGRNPTILRNKTSGVVHMKVYDKEAQQGSNSCQLNNGGCSQLCLPTSE
ITRTCMCTVGYYLQKNRMSCQGIESFLMYSVHEGIRGIPLEPSDKMDALMPISGTSFAVG
IDFHAENDTIYWTDMGFNKISRAKRDQTWKEDIITNGLGRVEGIAVDWIAGNIYWTDHGF
NLIEVARLNGSFRYVIISQGLDQPRSIAVHPEKGFLFWTEWGQMPCIGKARLDGSEKVVL
VSMGIAWPNGISIDYEENKLYWCDARTDKIERIDLETGGNREMVLSGSNVDMFSVAVFGA
YIYWSDRAHANGSVRRGHKNDATEMVTMRTGLGVNLKEVKVFNRVREKGTNVCAKDNGGC
KQLCLYRGHSRRTCACAHGYLAEDGVTCLRHEGYLLYSGRTILKSIHLSDETNLNSPIRP
YENPHYFKNVIALAFDYKQRRKGTNRIFYSDAHFGNIQLIKDNWEDRRIIVENVGSVEGL
AYHRAWDTLYWTSSTTSSITRHTVDQTRPGAFHKEAVITMSEDDHPHVLALDECQNLMFW
TNWNEQHPSIMRSTLTGKNAQVVVSTDILTPNGLTIDHRAEKLYFSDGSLGKIERCEYDG
SQRHVIVKSGPGTFLSLAVYDNYIFWSDWGRRAILRSNKYTGGDTTILRSDIPHQPMGII
AVANDTNSCELSPCALLNGGCHDLCLLTPSGRVNCSCRGDRILLDDNRCVTKNSSCNVYS
EFECGNGECIDYQLTCDGAPHCKDKSDEKLLYCENRSCRRGFKPCSNRRCVSHDRLCDGE
NDCGDNSDELDCKVSTCATLEFRCADGTCIPRSARCNQNIDCADASDEKNCNNTDCTHFY
KLGVKTTGFIRCNSTSLCVLPNWICDGSNDCGDYSDELKCPVQNKHKCEENYFGCPSGRC
ILNTWICDGQKDCEDGLDELHCDSSCSWNQFACSAHKCISKHWICDGEDDCEDGLDESDS
ICGAITCAADMFNCQGSHACVPRHWLCDGERDCPNGSDELSTAGCAPNNTCDENTFMCSN
KVCIPKQFVCDHDDDCGDGSDESLQCGYRQCSAEEFSCADGRCLLNSQWQCDGDLDCPDG
SDEAPFNPKCKNAEQSCNSSFFMCKNGRCIPSGGLCDNKDDCGDGSDERNCHINECLSKK
VSGCSQDCQDLPVSYKCKCWPGFQLKDDGKTCVDIDECSSGFPCSQQCINTYGTYKCFCT
DGYAIQPDNPNGCKSLSDEEPFLILADHHEIRKISTDGSNYTLLKQGLNNVIAIDFDYRE
EFIYWIDSSRPNGSRINRMCLNGSDVKVVHNTAVPNALAVDWIGKNLYWSDTEKRIIEVS
KLNGLYPTILVSKRLKFPRDLCLDPQAGYLYWIDCCEYPHIGRVGMDGTNQSVVIETKIS
RPMALTIDYVNHRLYWADENHIEFSNMDGSHRHQVPNQDIPGVIALTLFEDYIYWTDGKT
KSLSRAHKTSGADRLSLINSWHAITDIQVYHSYRQPDVSKHLCVINNGGCSHLCLLAPGK
THTCACPTNFYLAADNRTCLSNCTASQFRCKTDKCIPFWWKCDTVDDCGDGSDEPDDCPE
FKCQPGRFQCGTGLCALPAFICDGENDCGDNSDELNCDTHVCLSGQFKCTKNQKCIPVNL
RCNGQDDCGDEEDERDCPENSCSPDYFQCKTTKHCISKLWVCDEDPDCADASDEANCDKK
TCGPHEFQCKNNNCIPDHWRCDSQNDCSDNSDEEDCKPQTCTLKDFLCANGDCVSSRFWC
DGDFDCADGSDERNCETSCSKDQFQCSNGQCISAKWKCDHHEDCKFGEDEKNCEPASPTC
SSSEYICASGGCISASLKCNGEYDCADGSDEMECVTECNEDQFRCKNKAHCIPIRWLCDG
IHDCVDGSDEENCDRGGNICRADEFLCNNSLCKLHFWVCDGEDDCGDNSDEAPDMCVKFL
CPLTRPHRCRNNRICLQSEQMCNGIDDCGDNSDEDHCSGKVTYKARPCKKDEFACNNKKC
IPMDLQCDRLDDCGDGSDEEGCRITPTEYTCEDNVNPCGDDAYCNQIKTSVFCRCKPGFQ
RNMKNRQCEDLNECLVFGTCSHQCINTKGSYKCVCDHNFQERNNTCIAKGSEDQVLYIAN
DTDILGFIYPFNYSGNHQQISHIEHNSRITGMDVYYQRDMIIWSTQFNPGGIFYKRIHGR
EKRQANSGLICPEFKRPRDIAVDWVAGNIYWTDHSRMHWFSYYTTHWTSLRYSINVGQVN
GPNCTRLLTNMAGEPYAIAVNPKRGMMYWTVIGDHSHIEEAAMDGTLRRILVQKNLQRPT
GLAVDHFSERIYWADFELSIIGSVFYDGSDSVISVSSKQGLLHPHRIDIFEDYIYGAGPK
NGVFRVQKFGHGSVEFLALDVDKTKGVLISQRYKQVDLPNPCLDLACEFLCLLNPSGATC
ACPEGKHWINGTCRDGSLLDDSCKSTCENGGRCILNEKGDLRCHCWPSYSGERCEVNHCS
NYCQNGGTCTPSTLGRPTCSCALGFTGPNCGKTVCEDFCQNGGTCIVTAGNQPYCHCQSE
YTGDRCQYYVCHHYCVNSESCTIRDDGSVECVCPARYEGPKCEVDKCIRCHGGHCIINKD
NEDIFCNCTNGKIASSCQLCDGYCYNRGTCQLDPETNVPVCLCSTNWSGTQCERPAPKSS
KSDHISTRSIAIIVPLVLLVTLITTLVIGLVLCKRKRRTKTIRRQPIINGGINVEIGNPS
YNMYEVDHDHNDGGLLDPSFMIDTTK
Download sequence
Identical sequences G1TD94
ENSOCUP00000001920 ENSOCUP00000014803 9986.ENSOCUP00000014803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]