SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014839 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014839
Domain Number 1 Region: 40-158
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000111
Family V set domains (antibody variable domain-like) 0.0000107
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014839   Gene: ENSOCUG00000017274   Transcript: ENSOCUT00000017271
Sequence length 204
Comment pep:novel chromosome:OryCun2.0:7:144536484:144544163:1 gene:ENSOCUG00000017274 transcript:ENSOCUT00000017271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLGFQRQGTQLDLASRTWSCAALFSLLFLPVFSKALHVSQPAVVLASSRGVASFVCEY
ASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLS
AMDTGLYICKVELMYPPPYYVGMGNGTQIYVIDPEPCPDSDFLLWILAAISSGLFFYSFL
ITAVSLSKMVSVLLTMLHVYWECL
Download sequence
Identical sequences G1TDC7
ENSOCUP00000014839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]