SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014856 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014856
Domain Number 1 Region: 723-1002
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.05e-58
Family Tandem AAA-ATPase domain 0.0000863
Further Details:      
 
Domain Number 2 Region: 495-721
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.5e-55
Family Tandem AAA-ATPase domain 0.0000787
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000014856
Domain Number - Region: 245-294
Classification Level Classification E-value
Superfamily UBA-like 0.000357
Family CUE domain 0.026
Further Details:      
 
Domain Number - Region: 393-430
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00623
Family ComEA-like 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014856   Gene: ENSOCUG00000017283   Transcript: ENSOCUT00000017291
Sequence length 1025
Comment pep:known_by_projection chromosome:OryCun2.0:15:55656563:55737412:-1 gene:ENSOCUG00000017283 transcript:ENSOCUT00000017291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLFNLDRFRFEKRSKIEEAPEATPQPSQPGPSSPISLSAEEENAEGEVSRANTPDSDVT
EKTEDSSVPETPDNERKTSISYFKNQRGIQYIDLSSDSEDIVSPNCSNTVQEKKFNKDTV
IIVSEPSEDEESQGLPTMAQRNDISELEDFSELEDLKDAKLQTLKELFPQRSDSDLLKLI
DSTSTMDGAIAAALLMFGDAGGGPRKRKLSSSSEPYEEDEFNDDQSLKKTRIDHGEESNE
SAESSSNWEKQESIVLKLQKEFPNFDKQELREVLKEHEWMYTEALESLKVFAEDQDMQYA
SQNEVPNGKEVSSKGQNYPKNTTKTKLKQKFSVKPQNGFNKKRKKNVFNPKKVTEDSEYD
SGSDVGSSLDEDYSSGEEVMEDGYKGKILHFLQDASIGELTLIPQCSQKKAQKITELRPF
NSWEALFTKMSKTNGLSEDLIWHCKTLIQERDVVIRLMNKCEDISNKLTKQVTMLTGNGG
GWNIEQPSILNQSLSLKPYQKVGLNWLALVHKHGLNGILADEMGLGKTIQAIAFLAYLFQ
EGNKGPHLIVVPASTIDNWLREVNLWCPTLNVLCYYGSQEERKQIRCNIHSKYEDYNVIV
TTYNCAISSSDDRSLFRRLKLNYAIFDEGHMLKNMGSIRYQHLMTINANNRLLLTGTPVQ
NNLLELMSLLNFVMPHMFSSSTSEIRRMFSSKTKSADEQSIYEKERIAHAKQIIKPFILR
RVKEEVLKQLPPKKDQIELCTMSEKQEQLYLGLFNRLKKSINNLEKSTEMCNVMMQLRKM
ANHPLLHRQYYTAEKLKEMSQLMLKEPTHCEANPDLIFEDMEVMTDFELHVLCKQYRHIN
NFQLDMDLILDSGKFRVLGHILSELKQKGDRVVLFSQFTMMLDILEVLLKHHQHRYLRLD
GKTQISERIHLIDEFNTDMDIFVFLLSTKAGGLGINLTSANVVILHDIDCNPYNDKQAED
RCHRVGQTKEVLVIKLISQGTIEESMLKINQQKLKLEQDMTTVDEGDEGSMPADIATLLK
TSMGL
Download sequence
Identical sequences G1TDE1
ENSOCUP00000014856 XP_008265813.1.1745 XP_008265814.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]