SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000014991 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000014991
Domain Number 1 Region: 340-747
Classification Level Classification E-value
Superfamily Phosphofructokinase 6.28e-111
Family Phosphofructokinase 0.00000751
Further Details:      
 
Domain Number 2 Region: 16-338
Classification Level Classification E-value
Superfamily Phosphofructokinase 7.98e-105
Family Phosphofructokinase 0.000000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000014991   Gene: ENSOCUG00000017445   Transcript: ENSOCUT00000017447
Sequence length 780
Comment pep:known_by_projection scaffold:OryCun2.0:GL018949:202927:219365:1 gene:ENSOCUG00000017445 transcript:ENSOCUT00000017447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHEEHHAARTLGVGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGDHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRGITNLCVIGGDG
SLTGADTFRSEWSDLLSDLQKAGKITAEEATRSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRITEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDNWE
DHLCRRLSETRTRGSRLNIIIVAEGAIDRNGKPITSEGVKDLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQVTKDVTK
AMDEKRFDEAMKLRGRSFMNNWEVYKLLAHIRPPAPKSGSYTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQ
ISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQFDELCIPFVVIPATVSNNVPGSDFSV
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQANVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMAGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVTELQNQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHISRKRSGEATV
Download sequence
Identical sequences G1TDQ5
9986.ENSOCUP00000014991 ENSOCUP00000024936 ENSOCUP00000014991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]