SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015000 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015000
Domain Number 1 Region: 145-454
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.25e-86
Family Transglutaminase core 0.000000738
Further Details:      
 
Domain Number 2 Region: 4-144
Classification Level Classification E-value
Superfamily E set domains 1.71e-43
Family Transglutaminase N-terminal domain 0.00012
Further Details:      
 
Domain Number 3 Region: 473-585
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 2.22e-28
Family Transglutaminase, two C-terminal domains 0.0021
Further Details:      
 
Domain Number 4 Region: 587-685
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 4.71e-28
Family Transglutaminase, two C-terminal domains 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015000   Gene: ENSOCUG00000017459   Transcript: ENSOCUT00000017460
Sequence length 691
Comment pep:known_by_projection chromosome:OryCun2.0:17:29060804:29079853:1 gene:ENSOCUG00000017459 transcript:ENSOCUT00000017460 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHTLGIMSCDLQAARNNEEHHTKAISSRRLVVRRGQSFTVLLHFRTPVRRFLPTLKKVA
LVIQTGEQPSTANRTQAIFPISSLGDRKGWSAAVEERDDQSWTISVTTPADAVIGHYSLL
LQVSGRKQRLLGQFTLLFNPWNREDTVFLENEAQRREYVLNQNGLVYLGTADCIQEESWD
FGQFEGDVVDLSLALLSVDKQVEKWSQPVHVARVLGALLHALKEKSVLPTPQTQAAEEGA
LLNKRRGSVPILRQWLTGQGRPVYDGQAWVLAAVMCTVLRCLGVPARVVTTYASAQGTGG
GLLVDEYYNEEGLQNGEGQRGRVWIFQTSTECWMKRPALPQEYNGWQILYPTASGGSGVL
GACDLVPVRAIKEGILGLSPAVSDLFASVNASCVVWKCCEDGTLELTSSNTKYVGSNIST
KAVGSDRCEDITQHYKYPEGSIQEKEVLERVQKKRMEQGKDNGIPPPSVEMADPLYLFLE
APSSLPLRGEAQLSVILVNPSDQEKAVQLTIGAQAMYYNGVLATELWREKLSLTLSANLV
KRITTSLSFSYFEPHPPENSFLRLTAMATHSKSSLSCFAQEDVAICRPQLAIEMPETAEQ
YQPLTASVSLHNTLDAPMKDCVISILGRGLIHRERNYRLGPVWPGNMLCTQFQFTPTHLG
LHRLTVEMDCNMFQNLTNYRSVTVVAPELPA
Download sequence
Identical sequences G1TDR3
XP_008267335.1.1745 ENSOCUP00000015000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]