SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Oryctolagus cuniculus 76_2 > ENSOCUP00000015062

Domain assignment for ENSOCUP00000015062 from Oryctolagus cuniculus 76_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSOCUP00000015062
Domain Number 1	Region: 58-117
Classification Level	Classification	E-value
Superfamily	AN1-like Zinc finger	2.35e-16
Family	AN1-like Zinc finger	0.0000483
Further Details:

Domain Number 2	Region: 6-54
Classification Level	Classification	E-value
Superfamily	AN1-like Zinc finger	0.000000000000235
Family	AN1-like Zinc finger	0.0032
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSOCUP00000015062 Gene: ENSOCUG00000017532 Transcript: ENSOCUT00000017531
Sequence length	268
Comment	pep:known_by_projection chromosome:OryCun2.0:3:97344555:97361180:-1 gene:ENSOCUG00000017532 transcript:ENSOCUT00000017531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MAELDIGQHCQVEHCRQRDFLPFVCDGCSGIFCLEHRSKESHGCPEVTIINDRLKTDTHK SFPCSFKDCTERELVAVLCPYCEKNFCLRHRHQSDHECEKLEIPKPRMAATQKLVKDIID SKTKETASKRRKGAKNSETAAKVALMKLKMHADGDKSLPQTERIYFQVFLPKGSKEKSKP MFFCHRWSIGKVIDFAASLASLKNDNNKLTAKKLRLCHITSGEALPLDHSLETWIAKEDC PLFNGGNIILEYLNDEEQFLKNVDSYLE
Download sequence
Identical sequences	G1TDW5 ENSOCUP00000015062 XP_002710706.1.1745 ENSOCUP00000015062 9986.ENSOCUP00000015062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]