SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015233 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015233
Domain Number 1 Region: 24-150
Classification Level Classification E-value
Superfamily Lysozyme-like 1.23e-47
Family C-type lysozyme 0.0000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015233   Gene: ENSOCUG00000017738   Transcript: ENSOCUT00000017737
Sequence length 152
Comment pep:novel chromosome:OryCun2.0:16:5771912:5784218:-1 gene:ENSOCUG00000017738 transcript:ENSOCUT00000017737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGMRAAAILALVGCLATVTESKVYTRCKLAKIFSRAGLDNYEGFSLGNWICMAYYESH
YNTTAQTVLEDGSIDYGIFQINSFTWCRRAKTQEKNHCHVACSALLTDDLTDAIICAKKI
VKDTQGMNYWQGWKKHCEGKELSEWKKGCEVS
Download sequence
Identical sequences G1TEB7
XP_002717336.2.1745 ENSOCUP00000015233

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]