SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015875 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015875
Domain Number 1 Region: 5-226
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.02e-62
Family D-ribulose-5-phosphate 3-epimerase 0.00000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015875   Gene: ENSOCUG00000016995   Transcript: ENSOCUT00000031638
Sequence length 235
Comment pep:novel chromosome:OryCun2.0:7:150827415:150845079:1 gene:ENSOCUG00000016995 transcript:ENSOCUT00000031638 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDAPCSSGRSVFLHFVPNITFGHPV
VESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGM
KVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIE
VDGGVGPDTVHKCAEAGANMIVSGSAIMKSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences G1TG27
ENSOCUP00000015875 ENSOCUP00000015875 XP_008257318.1.1745 9986.ENSOCUP00000015875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]