SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015911 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015911
Domain Number 1 Region: 126-167,241-294
Classification Level Classification E-value
Superfamily SET domain 0.000000641
Family Histone lysine methyltransferases 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015911   Gene: ENSOCUG00000003131   Transcript: ENSOCUT00000023576
Sequence length 298
Comment pep:known_by_projection chromosome:OryCun2.0:11:72800459:72810484:1 gene:ENSOCUG00000003131 transcript:ENSOCUT00000023576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGRLLGACGSMAPFQVRFVPWIALNKNQRRPKTLRYVPEESKDKVLSDEDVLGTLLQLF
QALFLNDFSKQSDILAVLPEPVKSKYQDLWAVQHQRETLLGNSQPQNTFKPEEVLYKTLG
FCVVRAPSSVISAGKGVFVAKGLVPKGAVVSMYPGTVYQKHEPIFFQSIGNPFIFRCLDG
VLIDGNDKGISKVVYRSCSGRDRLGPLKMSDSTWLTAETDNPLAVGQYVNNCSNERAANV
CYQEFDVPAVFPVELKQYLPNTAYSYDRHSLLRCVVLIALRDIKQGEELFSNYYTIVS
Download sequence
Identical sequences G1TG62
9986.ENSOCUP00000015911 ENSOCUP00000015911 ENSOCUP00000002716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]