SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000015964 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000015964
Domain Number 1 Region: 477-737
Classification Level Classification E-value
Superfamily YWTD domain 2.22e-54
Family YWTD domain 0.0000000212
Further Details:      
 
Domain Number 2 Region: 43-80
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000101
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 3 Region: 295-333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 4 Region: 165-200
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000445
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 84-127
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 6 Region: 204-239
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000115
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 7 Region: 258-293
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.00067
Further Details:      
 
Domain Number 8 Region: 120-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000288
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 9 Region: 429-468
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000724
Family EGF-type module 0.0017
Further Details:      
 
Domain Number 10 Region: 393-437
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000879
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 11 Region: 337-375
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.00056
Further Details:      
 
Domain Number 12 Region: 748-788
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000366
Family EGF-type module 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000015964   Gene: ENSOCUG00000016645   Transcript: ENSOCUT00000025895
Sequence length 957
Comment pep:known_by_projection chromosome:OryCun2.0:13:113475513:113542602:1 gene:ENSOCUG00000016645 transcript:ENSOCUT00000025895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTPVVSNTTPSLRQAAWGAWWGAGLKSADPSPPPPTTAGPVKECEEHQFQCRNGRCIP
SVWRCDEDDDCSDNSDEDDCPKKTCADSDFTCDNGHCIPERWKCDGEEECPDGSDESKAA
CTKQECPAEKLSCGPTSHKCVPASWRCDGEKDCESGADEAGCAPLCAPHEFRCGNRSCLA
AVFVCDGDDDCGDGSDERGCADPACGPLEFRCGGGGGTCIPERWVCDRQLDCEDGSDEAA
DLCGHAGPGATAAPSACAPAVQFACRSGECVHLGWRCDGDHDCKDKSDEADCPAPGTCRG
DEFRCGDGTCVLATKRCDQEQDCRDGSDEAGCLQESTCEGPRSFQCTSGECVDSGKVCDA
QRDCRDWSDELLKECVAPTFRGNRRRPRGLNECQHNNGGCSHICTDRRIGFECSCPAGFR
LLDQKTCGDIDECEDPDACSQICVNYKGYFKCECHPGYEMDTLSKNCKAAAGKSPSLIFT
NRHEVRKIDLVRREHSRLIPMLKNVVALDVEVATNRIYWCDLSYRKIYSAYMDKASDPAE
QEVLIDEQLHSPEGLAVDWVHKHMYWTDSGNKTISVATVDGGRRCTLFSRDLSEPRAIAV
DPLRGFMYWSDWGFQAKIEKSGLNGADRQTLVSDNIEWPNGITLDLLNQRLYWVDSKLHQ
LSSIDFSGGNRKMLISSPDFLSHPFGIAVFEDKVFWTDLENEAILSANRLNGLEISFLAE
NLNNPHDIVIFHELKQPRAADACELSAQPNGGCEYLCLPAPQLSSHSPQYTCACPDTMWL
GPDMKRCYRAPPSTSTTTLASTTTSTAAATTRAPGTTVHSPTYQNHSTETPSLAAAVPSS
VSVPGAPGISPSTPSPATSNHSQHYGNEGGKMGSPVTAAVIGIIVPIVVVALLCISGYLI
WRNWKRKNTKSMNFDNPVYRKTTEEEDDDELHIGRTAQIGHVYPARVALSIEDDGLP
Download sequence
Identical sequences G1TGB4
ENSOCUP00000015964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]