SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000016069 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000016069
Domain Number 1 Region: 3-244
Classification Level Classification E-value
Superfamily SET domain 8.72e-63
Family Histone lysine methyltransferases 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000016069   Gene: ENSOCUG00000026652   Transcript: ENSOCUT00000021367
Sequence length 264
Comment pep:known_by_projection scaffold:OryCun2.0:GL018703:3799550:3801160:-1 gene:ENSOCUG00000026652 transcript:ENSOCUT00000021367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQYTPDHVEGPGADTDPTQAVFPGCACTTAPCLPGTCSCLRWQENYDDHLRLRGIGAEAD
HAVPVFECNIMCQCSDRCRNRVVQRGLQFHLQVFQTDLKGWGLRTLEFIPKGRFVCEYAG
EILGSSEAQRRIHLQTIHDSNYILAVREHVSQGQVLATFVDPTHTGNVGRFLNHSCAPNL
LMVPVRIDSMVPKLALFAAKDILPGEELCYDYSGRFLNRSDGEDKDGLDNGKLRKPCYCG
AKSCTAFLPYDSSLYCPGPHPWTF
Download sequence
Identical sequences G1TGL9
ENSOCUP00000016069 ENSOCUP00000016069 9986.ENSOCUP00000016069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]