SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000016074 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000016074
Domain Number - Region: 85-125
Classification Level Classification E-value
Superfamily GAF domain-like 0.051
Family GAF domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000016074   Gene: ENSOCUG00000021254   Transcript: ENSOCUT00000024758
Sequence length 194
Comment pep:novel scaffold:OryCun2.0:GL019099:95518:96102:-1 gene:ENSOCUG00000021254 transcript:ENSOCUT00000024758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPWGEYFSDGSQVSCQTCQEQRLQGEVVAFDYQSKMLALKCPSSSGKPNHTDILLINL
QYVSEVEIMNDRTETPPPLASLNISKLASKAWTEKDKKLSQAYAISAGVSLEGQQLFQTI
HKTNKDCKWQEKNIVAMEEVVITPPYQVENCKGKEGSALSHVCKIVEKHFRDVESQKILQ
CSQAQQPQKEAALS
Download sequence
Identical sequences G1TGM4
9986.ENSOCUP00000016074 ENSOCUP00000016074 ENSOCUP00000016074

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]