SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000016100 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000016100
Domain Number 1 Region: 1043-1170
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000157
Family GAF domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000016100
Domain Number - Region: 883-921
Classification Level Classification E-value
Superfamily EF-hand 0.00338
Family Calmodulin-like 0.048
Further Details:      
 
Domain Number - Region: 286-406
Classification Level Classification E-value
Superfamily EF-hand 0.0272
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000016100   Gene: ENSOCUG00000025537   Transcript: ENSOCUT00000031041
Sequence length 1515
Comment pep:known_by_projection chromosome:OryCun2.0:19:18153492:18280503:-1 gene:ENSOCUG00000025537 transcript:ENSOCUT00000031041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESTSQEEPRPAQKNEKEGKERHQDSTEMKESIESSQNVADVSVTEASNNVGEEATDEI
KPQELTPEEQPTTSVDSIKDPHTRVSGNIAVRKPAKVILGLDESEQTSQLEQPWKKNLFE
RVEARAQAMQQKIIDKDNLKKELEKKAEKILPKDNLAKEWFNTESLTLNTRVYLLDKLLP
TLVPAVEQMLTQMEKKKLQTEADIPTKFDPINHLGEYLMRNNPHYIKDQGMSGYQRVMRD
VTEDLKIHVPDTVCNRVSKMKEKVKQKREQRESVSKVKVKVANMRKQALQEQFNEWILDP
KGMIPLVVVQNVLHEFLQKPEVQLESYCQQLDITGSMEPGLNKMEFTEYISSHIADFKSE
TFEELLKHLCHCADEFREVIKADMRRQIFAELFLYCDRGKVGILDRQRTLALLEMFYDQS
PQMLRSLLRNPRQWPFVEFEEIVLPEFWGDMDNQKHIYEDFDKVLLEMNTLLSEKNDSKN
QSKLLENSEEQQKRNEQRKSTPSLNTPEQQKVTTAEQGSHRISTEEQGRRPTAEQELHRE
SVTEEGAYTESTPDRRSIRELVPEQEPYKGSTAGQEPGRLSASEQGSHRGSVVEQGPRKV
SVAEPATRRESTIEPGARRVSAAESGSRRGSAIEPGARRASAAEPGSRRGESIVEEQHKE
SEQRPQRQTTPEEQQDIDSTSQSREESNIKESTKSRAAIPSGYTEIPSQEKSSSEQAYEE
EPLVRSELQGEVPTSSKKDHISGATKKEAEESILCLKTCNEISTQQRKQEFWALGYFMKY
KSFELSESIVYCLACVSCLTDLHSIIRNIQSYKEVKGRSAFSGVSFNLLQFVQLLETFVG
EDTSLSVSETLATFFKRGYVERKEEKMSALEQVKQNAFRVRRGLLLEALFQKWDSDSSGF
LDVKEVDELLYTYKQGMEKESMKKGKMNLSFPKPHPGHEVRLSSKQFQKYELVVSELRGN
EDQVLESVVEFLMNTLERSHIESLRNCARRKWLHQIQHAAETSGVSLEPVYTETFKALTQ
DAEAHGNKKISAHISLLEENVLLPHRGSVTLRNVACTLDDAPFVLNKVLYRDMKGISFTV
VDEGKPIHVPQVQYHGNIFFWNHSRNKEDYSGSFLALPLQDAYMRIFGVLAVDTLRDPHE
INIFLPHEIRFYQGVANVFSAAYHYIHSREHILHIVITGIGWLYSITSGITSITTLFVEP
SPNQDSDYVLRSMMVTRQLGLTEIHTNSPTISRKSCIFRDFLFKCTDSSQVVLASVCGET
HIVVPLRERTGEALGVLDFNIGRTRMLLYQEYKDLQKMMKVIQAACYETLDELSGERKRK
CVLEIEDVGEVQRAGIIFFRIMLQELQECLQLLDSMSFVSLLLYDHSTIVQTEPLPDSKT
RELAANINLVQDILKGVILFFHPELEFSSDFQNWDKCKLYVNRYLVRNICAFDPTASDLE
INLQLIEKYLRTDHSRAEVWSFGDIVIELLYHWVHVCLALIDLKNKKRTSAITPPLPSKT
NYVCAKMPGASLPGK
Download sequence
Identical sequences G1TGQ0
9986.ENSOCUP00000016100 ENSOCUP00000019590 ENSOCUP00000016100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]