SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000016733 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000016733
Domain Number 1 Region: 14-61
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000259
Family V set domains (antibody variable domain-like) 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000016733   Gene: ENSOCUG00000025817   Transcript: ENSOCUT00000025293
Sequence length 63
Comment pep:novel scaffold:OryCun2.0:GL018758:1394050:1394383:1 gene:ENSOCUG00000025817 transcript:ENSOCUT00000025293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WAVLWLLGAEHTDAGVSQSPRHRVTGRGQNVTLTCDPESGHNTLYWYRQSQGQGLQLMMY
FQG
Download sequence
Identical sequences G1TIG3
9986.ENSOCUP00000016733 ENSOCUP00000016733 ENSOCUP00000016733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]