SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000017035 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000017035
Domain Number 1 Region: 2-147
Classification Level Classification E-value
Superfamily Globin-like 8.39e-56
Family Globins 0.000000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000017035   Gene: ENSOCUG00000021180   Transcript: ENSOCUT00000028812
Sequence length 147
Comment pep:known chromosome:OryCun2.0:1:146252321:146253705:-1 gene:ENSOCUG00000021180 transcript:ENSOCUT00000028812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVHFTAEEKAAITSTWKLVDVEDAGAEALGRLLVVYPWTQRFFDSFGNLSSSSAIMGNPK
VKAHGKKVLTAFGDAVKNVDDLKNTFAHLSELHCDRLHVDPENFKLLGNVLVIVLAKYFG
KEFTPQVQSAWQKLVAGVATALAHKYH
Download sequence
Identical sequences B8K175 P02099
ENSOCUP00000017035 9986.ENSOCUP00000017035 ENSOCUP00000017035 NP_001164974.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]