SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000017314 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000017314
Domain Number 1 Region: 1-219
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.05e-70
Family Phosphofructokinase 0.00000613
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000017314   Gene: ENSOCUG00000026677   Transcript: ENSOCUT00000024529
Sequence length 221
Comment pep:known_by_projection scaffold:OryCun2.0:GL019906:311:6464:-1 gene:ENSOCUG00000026677 transcript:ENSOCUT00000024529 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIQPASWLSVSNIIQLGGTIIGSAR
CKAFTTREGRLAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGSLLEELVQEGKISES
TAQTYSHLNIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVM
GRHCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGE
Download sequence
Identical sequences G1TK32
ENSOCUP00000017314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]