SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000017668 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000017668
Domain Number 1 Region: 306-438
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.75e-48
Family Eukaryotic proteases 0.00078
Further Details:      
 
Domain Number 2 Region: 94-183
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000445
Family Scavenger receptor cysteine-rich (SRCR) domain 0.05
Further Details:      
 
Domain Number 3 Region: 73-97
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000694
Family LDL receptor-like module 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000017668   Gene: ENSOCUG00000027374   Transcript: ENSOCUT00000021243
Sequence length 446
Comment pep:novel chromosome:OryCun2.0:1:98605266:98616808:1 gene:ENSOCUG00000027374 transcript:ENSOCUT00000021243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPHRAGPSPTASPAPTTALLLGTSGPKFSWQEGQKRLPLIGCILFITLVVSLIVLFHFWR
GHTGIKYKEPVESCPSHTVRCDGVVDCKLQSDELGCVRFDWDSSLLKVYSGSSHQWLPVC
SHSWNNSFSEKTCRQLGFKRPGTPALTSLAQDTLSPVSLGQAGPTRPNCNSVRPLCGSST
LVSLATFNCPITILSGDTLETGEYGTGLIFLHQVSQALGWTLSHISHGLAGETHKWELER
GQMWPNQEKHLETRSWRLGWELEQGLGRAGHTPRAATPSSLVCRAGAARGQTFYPCPSLT
SGPLTAAHVHPACLPMHGQTFSLNETCWITGFGKTKETDEKTSPFLREVQVNLIDFRKCN
DYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLVCQQNNRWYLAGVTSWGTGCGQRNKP
GVYTKVTEALSWIYSKMESETRFRKS
Download sequence
Identical sequences G1TL24
9986.ENSOCUP00000017668 ENSOCUP00000017668 ENSOCUP00000017668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]