SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018291 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018291
Domain Number 1 Region: 32-69
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000484
Family LDL receptor-like module 0.0006
Further Details:      
 
Domain Number 2 Region: 104-146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000838
Family LDL receptor-like module 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018291   Gene: ENSOCUG00000025026   Transcript: ENSOCUT00000025490
Sequence length 247
Comment pep:known_by_projection scaffold:OryCun2.0:GL018767:393887:399049:1 gene:ENSOCUG00000025026 transcript:ENSOCUT00000025490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAQPSTWAWRTAPSPVATRLWAQAPGSSTGSCPPSSFQCRASGYCVPLTWRCDGDPDCS
DGSDEEECRIEPCTQNGQCPPPPGLPCSCDNISDCPGGGHQGLHNCSRQPCPAGEIRCSL
GDACIPHTWRCDGHRDCPDSSDELGCGLFAEINETLQDRNATTAGTPVTPTTVTPLRNAT
AASVGYQAANPSAYGLAAAAVVLSAGLATAALVMLSRLRAQGHVPPPGLLAAVKESLLLS
RRKTSLL
Download sequence
Identical sequences G1TMS9
ENSOCUP00000018291

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]