SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018327 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018327
Domain Number 1 Region: 51-173
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.03e-21
Family Synaptotagmin-like (S variant) 0.039
Further Details:      
 
Domain Number 2 Region: 219-270
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000493
Family CUE domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018327   Gene: ENSOCUG00000023171   Transcript: ENSOCUT00000022606
Sequence length 273
Comment pep:known_by_projection scaffold:OryCun2.0:GL019052:9197:29885:-1 gene:ENSOCUG00000023171 transcript:ENSOCUT00000022606 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTVSTQRGPVYIGELPQDFLRITPTQQQQQIQLDAQAAQQLQYGGAVGTVGRLSVTVV
QAKLAKNYGMTRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGDSFYLEIFD
ERAFSMDDRIAWTHITIPESLKQGKVEDEWYSLSGRQGDDKEGMINLVMSYTALPAAMVM
PPQPVVLMPTVYQQGVGYVPIAGMPAVCGPGMVPVAVPPPAVRAQPRCSEEDLKAIQDMF
PSMDKEVIRSVLEAQHGSKDAAVNSLLQMGEES
Download sequence
Identical sequences G1TMW2
ENSOCUP00000018327 ENSOCUP00000018327 9986.ENSOCUP00000018327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]