SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018355 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018355
Domain Number 1 Region: 304-506
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.13e-61
Family Eukaryotic proteases 0.00053
Further Details:      
 
Domain Number 2 Region: 167-263
Classification Level Classification E-value
Superfamily SRCR-like 3.79e-18
Family Scavenger receptor cysteine-rich (SRCR) domain 0.06
Further Details:      
 
Domain Number 3 Region: 136-170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000327
Family LDL receptor-like module 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000018355
Domain Number - Region: 35-87
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0968
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018355   Gene: ENSOCUG00000024741   Transcript: ENSOCUT00000025819
Sequence length 509
Comment pep:known_by_projection scaffold:OryCun2.0:GL019053:118986:150744:-1 gene:ENSOCUG00000024741 transcript:ENSOCUT00000025819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASEGHLERPAYLPLPDAADKSRMALNSGLSPGVGPYYENHGYQPENLYARQPPVAPHVY
TVYPAQYYPSPVPQYTPRVVTQAATPAVRRQPRSGSGTSCTPKAKKALCITFALGAVLVG
AGLVIGLLWNFLEGRCSGMECGPSRICIRTSQWCDGVLHCPNGEDENRCVRLYGPNFILQ
VYSSQRKSWHPVCQDDWNESYGRAACKDMGYQSFYTSSGIADNSGATSFMKLNLSASNHD
LYQKLYHSDTCSSKAVVSLRCIEDTAKALSFVSPRAGGSRRGALTQPCDTATWTQGVHLV
GRKILLTPISTSHTLDKPLNSARYWMAFAGILSQFSMLYPSGYQAEKVISHPNYDSKTKN
NDIALIKLQTPLTFNDRVRPVCLPNPGLMLEPEQPCWISGWGATYEKGKTSDLLNAAMVP
LIESWKCNSKYVYNNLITPSMICAGYLQGTIDSCQGDSGGPLVTLKNDIWWLIGDTSWGS
GCAKVNRPGVYGNVTAFTDWIYQQMRVTY
Download sequence
Identical sequences G1TMY8
ENSOCUP00000018355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]