SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018814 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018814
Domain Number 1 Region: 275-561
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.18e-98
Family PDEase 0.000000974
Further Details:      
 
Domain Number 2 Region: 18-55,82-198
Classification Level Classification E-value
Superfamily GAF domain-like 7.85e-22
Family GAF domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018814   Gene: ENSOCUG00000022334   Transcript: ENSOCUT00000030886
Sequence length 575
Comment pep:novel scaffold:OryCun2.0:GL019129:132023:155729:-1 gene:ENSOCUG00000022334 transcript:ENSOCUT00000030886 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVTMPASRIGAGVLLWSANKVFEELTDIERQFHKAFYTVRAYLNCDRYSVGLLDMTKEK
EFFDVWPVLMGEAQPYSGPRTPDGREIVFYKVIDYILHGKEDIKVIPTPPADHWALASGL
PTYVAESGFICNIMNTSADEMFKFQDGPLDDSGWVIKNVLSMPIVNKKEEIVGVATFYNR
KDGKPFDEQDEVIMESLSRTRDWGILGTRGGCPSTCCPWEPWEGAGDMAPLCHHRRMQGT
WLLRVTPTRDRLGKEPADCEEDELGLILKEELPGPSKFDIYEFHFSDLECTELELVKCGI
QMYYELGVVRKFQIPQEVLVRFLFSVSKAYRRITYHNWRHGFNVAQTMFTLLMTGKLKSY
YTDLEAFAMVTAGLCHDIDHRGTNNLYQMKSQNPLAKLHGSSILERHHLEFGKFLLSEES
LNIYQNLNRRQHEHVIHLMDIAIIATDLALYFKIHKIFYNCYLNSQTIPYHKRSFYFCGL
CCARRAMMMTACDLSAITKPWEVQSKVALLVAAEFWEQGDLERTVLDQQPIPMMDRNKAA
ELPKLQVGFIDFVCTFVYKLRGDRVTVSRRASSHT
Download sequence
Identical sequences G1TP82
ENSOCUP00000018814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]