SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000018876 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000018876
Domain Number 1 Region: 7-152
Classification Level Classification E-value
Superfamily Globin-like 2.32e-55
Family Globins 0.00000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000018876   Gene: ENSOCUG00000027533   Transcript: ENSOCUT00000021222
Sequence length 152
Comment pep:known chromosome:OryCun2.0:1:146261868:146263259:-1 gene:ENSOCUG00000027533 transcript:ENSOCUT00000021222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRRDTMVHFTPEEKCIISKQWGQVNIDETGGEALGRLLVVYPWTQRFFDNFGNLSSSSAI
MGNPKVKAHGKKVLTSFGDAIKNMDNLKGAFAKLSELHCDKLHVDPENFKLLGNVLLIVL
ATHFGKEFTPEVQAAWQKLVSGVAIALAHKYH
Download sequence
Identical sequences G1TPE2
ENSOCUP00000018876 ENSOCUP00000018876 9986.ENSOCUP00000018876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]