SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019197 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000019197
Domain Number 1 Region: 34-94
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000343
Family Cold shock DNA-binding domain-like 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000019197
Domain Number - Region: 124-159
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00698
Family Retrovirus zinc finger-like domains 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019197   Gene: ENSOCUG00000011640   Transcript: ENSOCUT00000011636
Sequence length 169
Comment pep:novel chromosome:OryCun2.0:14:30749334:30749867:1 gene:ENSOCUG00000011640 transcript:ENSOCUT00000011636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFAGGCTEATEKAPEEAPEDATRVADEPQLLHGAGICKWFNVRMSMTARAGLEVDVFVHQ
SKLHMEGFRSLKEGEAVEFTFKKSAKGLESIRVTGPGGVFCISSERRPKGKSMQKRRSKG
GKGYNCGLDHHAKECKLPPQPKKCHCQSISHMVASCPLKAQQAPSAQGK
Download sequence
Identical sequences G1TQA2
ENSOCUP00000019197 9986.ENSOCUP00000019197 ENSOCUP00000019197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]