SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000019590 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000019590
Domain Number 1 Region: 1075-1202
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000167
Family GAF domain 0.023
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000019590
Domain Number - Region: 860-951
Classification Level Classification E-value
Superfamily EF-hand 0.00502
Family Calmodulin-like 0.059
Further Details:      
 
Domain Number - Region: 347-437,914-951
Classification Level Classification E-value
Superfamily EF-hand 0.0111
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000019590   Gene: ENSOCUG00000025537   Transcript: ENSOCUT00000022088
Sequence length 1548
Comment pep:known_by_projection chromosome:OryCun2.0:19:18153374:18280503:-1 gene:ENSOCUG00000025537 transcript:ENSOCUT00000022088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSESTSQEEPRPAQKNEKEGKERHQDSTEMKESIESSQNVADVSVTEASNNVGEEATDEI
KPQELTPEEQPTTSVDSIKDPHTRVSGNIAVRKPAKVILGLDESEQTSQLEQPWKKNLFE
RVEARAQAMQQKIIDKDNLKKELEKKAEKILPKDNLAKEWFNTESLTLNTRVYLLDKLLP
TLVPAVEQMLTQMEKKKLQTEADIPTKFDPINHLGEYLMRNNPHYIKDQGMSGYQRVMRD
VTEDLKIHVPDTVCNRVSKMKEKVKQKREQRESVSKVKVKVANMRKQALQEQFNEWILDP
KGMIPLVVYISSHIADFKSETFEELLKHLCHCADEFREVIKADMRRQIFAELFLYCDRGK
VGILDRQRTLALLEMFYDQSPQMLRSLLRNPRQWPFVEFEEIVLPEFWGDMDNQKHIYED
FDKVLLEMNTLLSEKNDSKNQSKLLENSEEQQKRNEQRKSTPSLNTPEQQKVTTAEQGSH
RISTEEQGRRPTAEQELHRESVTEEGAYTESTPDRRSIRELVPEQEPYKGSTAGQEPGRL
SASEQGSHRGSVVEQGPRKVSVAEPATRRESTIEPGARRVSAAESGSRRGSAIEPGARRA
SAAEPGSRRGSTIEPGGRRASVAEPGSRRGSTIEPGARRASAAEPGSQRESVSGQFQHKG
SEGGQGSQRVSLSESRSHRESIVEEQHKESEQRPQRQTTPEEQQDIDSTSQSREESNIKE
STKSRYTEIPSQEKSSSEQAYEEEPLVRSELQGEVPTSSKKDHISGRSYKKGSTMTTSKY
KTGKNLSCKQPKQELKNNSRTTTSLLLSCTHLFSLRSESIVYCLACVSCLTDLHSIIRNI
QSYKEVKGRSAFSGVSFNLLQFVQLLETFVGEDTSLSVSETLATFFKRGYVERKEEKMSA
LEQVKQNAFRVRRGLLLEALFQKWDSDSSGFLDVKEVDELLYTYKQGMEKESMKKGKIYT
SSFPKPHPGHEVRLSSKQFQKYELVVSELRGNEDQVLESVVEFLMNTLERSHIESLRNCA
RRKWLHQIQHAAETSGVSLEPVYTETFKALTQDAEAHGNKKISAHISLLEENVLLPHRGS
VTLRNVACTLDDAPFVLNKVLYRDMKGISFTVVDEGKPIHVPQVQYHGNIFFWNHSRNKE
DYSGSFLALPLQDAYMRIFGVLAVDTLRDPHEINIFLPHEIRFYQGVANVFSAAYHYIHS
REHILHIVITGIGWLYSITSGITSITTLFVEPSPNQDSDYVLRSMMVTRQLGLTEIHTNS
PTISRKSCIFRDFLFKCTDSSQVVLASVCGETHIVVPLRERTGEALGVLDFNIGRTRMLL
YQEYKDLQKMMKVIQAACYETLDELSGERKRKCVLEIEDVGEVQRAGIIFFRIMLQELQE
CLQLLDSMSFVSLLLYDHSTIVQTEPLPDSKTRELAANINLVQDILKGVILFFHPELEFS
SDFQNWDKCKLYVNRYLVRNICAFDPTASDLEINLQLIGSYIPDHSRAEVWSFGDIVIEL
LYHWVHVCLALIDLKNKKRTSAITPPLPSKTNYPGRSAPSTRSVPSCL
Download sequence
Identical sequences G1TRD5
ENSOCUP00000019590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]