SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020962 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020962
Domain Number 1 Region: 2-111
Classification Level Classification E-value
Superfamily Serpins 7.86e-28
Family Serpins 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020962   Gene: ENSOCUG00000026029   Transcript: ENSOCUT00000026077
Sequence length 112
Comment pep:known_by_projection chromosome:OryCun2.0:1:141174524:141175285:-1 gene:ENSOCUG00000026029 transcript:ENSOCUT00000026077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMHRTGLYNYYDDEKEKLQMVEMPLAHK
LSSLIIIMPHHVEPLERLEKLLTKEQLKTWMGKMQKKAVAISLPKGVVEVTH
Download sequence
Identical sequences G1TV79
9986.ENSOCUP00000020962 ENSOCUP00000020962 ENSOCUP00000020962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]