SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000020974 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000020974
Domain Number 1 Region: 93-219
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.32e-44
Family Glutathione S-transferase (GST), C-terminal domain 0.00000164
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.29e-17
Family Glutathione S-transferase (GST), N-terminal domain 0.0000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000020974   Gene: ENSOCUG00000023448   Transcript: ENSOCUT00000031257
Sequence length 224
Comment pep:novel chromosome:OryCun2.0:13:54475701:54480899:1 gene:ENSOCUG00000023448 transcript:ENSOCUT00000031257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVTLGYWDIRSVRGAVRMLLEYMDSSYKEPACFNLCPAPRVPNYDQSKWLSEKFTLGLD
FPQLPYLIDGTHKLTQSNAILRYLARKHGLCEGETEEEKIRVDIQENQLMDNRMQFAMMC
YSPDVEKLKPEYLKGLPEKLQLYSQFLGKRPWFAGDKITFADFLVYNILDQNRIFEPGCL
DAFPNLKDFMSRFEGLPKISAYMKSSRFLRVPVCAKTAKPWGGF
Download sequence
Identical sequences G1TV91
ENSOCUP00000020974 9986.ENSOCUP00000020974 ENSOCUP00000020974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]