SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021032 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000021032
Domain Number - Region: 32-110,168-225
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000122
Family Hypothetical protein TT1662 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021032   Gene: ENSOCUG00000024527   Transcript: ENSOCUT00000029719
Sequence length 246
Comment pep:novel scaffold:OryCun2.0:GL018711:1520115:1520953:-1 gene:ENSOCUG00000024527 transcript:ENSOCUT00000029719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAELDYTIEIPDQPFWSQKSSSSQAGKEAGTRQPVVILLGWGGCKDKNLAKYSALYHK
RRLLELLFDYEIEKEPLLFHVFSNAGIMLCRYVLELPHTHQRFCHLRVVGTIFDSGPGDS
NVVRALRALAVILEHWPAVLRLLLLVAFALVAVLFHVLLAPLTALFHNFYDRLQDAGSHW
PELYLYSKADEVVLARDMERMVEARLSRRVLVRSDFVSSAHVSHLRDYPTYYTSLCVDFM
HNCVHC
Download sequence
Identical sequences G1TVE8
ENSOCUP00000021032 ENSOCUP00000021032 9986.ENSOCUP00000021032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]