SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021054 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021054
Domain Number 1 Region: 62-181,257-362
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 4.71e-64
Family FabD-like 0.000088
Further Details:      
 
Domain Number 2 Region: 190-264
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.00000144
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021054   Gene: ENSOCUG00000015843   Transcript: ENSOCUT00000023770
Sequence length 388
Comment pep:known_by_projection scaffold:OryCun2.0:GL019017:16562:26899:1 gene:ENSOCUG00000015843 transcript:ENSOCUT00000023770 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRVARAAWARGWGAGWHRGATSVAGPPSGAVDVAELLRDATAAEEPRAAAARREPGRC
SVLLFPGQGSQLVGMGRGLLGFPRVRELYDAASRVLGYDLLALSLHGPQEDLDRTVHCQP
AIFVASLAAVEKLHHLQPEVIENCVAAAGFSVGEFAALVFAGAMDFSEGLYAVKIRAEAM
QEASEAVPSGMLSVLGQRQSKFPLACADAREHCRSLGIEEPVCEVSNYLFPDCRVVAGHL
EALHFLQRNAARYHFRRTKMLPVSGGFHTRLMEPALEPLAQALKTVDIKKPLVSVHSNVT
GHRYAHPGHIRKLLLQQVVSPVKWEQTMHAIYERKKGTEFPRTFEVGPGQQLGAILKSCN
LQAWKSYSSVDVLRASEDPGPDPVETLR
Download sequence
Identical sequences G1TVH0
XP_002723692.1.1745 ENSOCUP00000021054 ENSOCUP00000021054 9986.ENSOCUP00000021054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]