SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021086 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021086
Domain Number 1 Region: 1820-2066
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.38e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 937-1067
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000738
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 3 Region: 594-725
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000014
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 412-536
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 5 Region: 782-915
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000691
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 6 Region: 1097-1229
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000165
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 757-793
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000187
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 8 Region: 146-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000294
Family EGF-type module 0.012
Further Details:      
 
Domain Number 9 Region: 532-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000687
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 10 Region: 1225-1274
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000982
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 260-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000427
Family EGF-type module 0.018
Further Details:      
 
Domain Number 12 Region: 716-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000643
Family EGF-type module 0.015
Further Details:      
 
Domain Number 13 Region: 91-225
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000706
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 14 Region: 222-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000839
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 15 Region: 1424-1456
Classification Level Classification E-value
Superfamily Notch domain 0.000000102
Family Notch domain 0.0015
Further Details:      
 
Domain Number 16 Region: 1305-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000105
Family EGF-type module 0.015
Further Details:      
 
Domain Number 17 Region: 1264-1308
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000129
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 18 Region: 1064-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000136
Family EGF-type module 0.022
Further Details:      
 
Domain Number 19 Region: 1377-1416
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000163
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 20 Region: 298-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000201
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 21 Region: 377-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000232
Family EGF-type module 0.022
Further Details:      
 
Domain Number 22 Region: 1503-1534
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0034
Further Details:      
 
Domain Number 23 Region: 570-605
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000153
Family EGF-type module 0.01
Further Details:      
 
Domain Number 24 Region: 335-375
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000164
Family EGF-type module 0.018
Further Details:      
 
Domain Number 25 Region: 65-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000202
Family EGF-type module 0.015
Further Details:      
 
Domain Number 26 Region: 28-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000401
Family EGF-type module 0.018
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000021086
Domain Number - Region: 1466-1497
Classification Level Classification E-value
Superfamily Notch domain 0.00131
Family Notch domain 0.0084
Further Details:      
 
Domain Number - Region: 917-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0324
Family EGF-type module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021086   Gene: ENSOCUG00000016565   Transcript: ENSOCUT00000026604
Sequence length 2472
Comment pep:known_by_projection chromosome:OryCun2.0:13:44014973:44186377:-1 gene:ENSOCUG00000016565 transcript:ENSOCUT00000026604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRRAALWALLALWLSRAAPARALQCRDGYEPCVNEGICVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCLNGGT
CHTHSRDTFECTCQVGFTGKLCQWTDACLSHPCANGSTCTTVANQFSCKCLPGFTGQKCE
TDVNECDIPGQCQHGGTCLNLPGSYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGNTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGDYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECT
MANSNPCEHAGKCMNTDGAFYCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCGENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASSPCVHGVCV
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCVNDVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYR
CTCEKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGNNCQTVLAPCSPN
PCENGAVCKEAPDFESYTCVCAPGWQGQRCTIDIDECVSKPCLNHGLCHNTQGSYMCECP
PGFSGMDCEEDINDCLANPCQNGGSCMDRVNTFSCLCLPGFIGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGP
FCLHEINECNSHPCLNEGTCVDGLGTYRCTCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQ
EKAESRCLCPSGWAGAYCDVPSVSCSIAALRRGVSVAHLCQHSGVCIDAGSTHHCQCPLG
YTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCAGGPHCLNGGQCVDRIGGYSCRCLPGFAGER
CEGDINECLSSPCSSEGSLDCIQLTNNYLCVCRSAFTGRHCETFVDVCPQMPCMNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCVHTASGPRCFCPNPQDCDAGCAS
SPCQHGGSCYPQRQPPYYSCHCAPPFWGSHCELYSAPTSSPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMEDPWANCSSPLPCWDYINNQCDELCNTAECLFDNFECQGNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADRPENLAEGTLVIVVLMPPEQLLQ
DARSFLRALGTLLHTNLRIKRDSQGDLMVYPYYGEKSAAMKKQRMTRRSLPDEQEQEVAG
SKVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLAPKPTQLLY
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVDDEGPQPKKAKAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDVSDEDEDAEDSAANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRPFLSLKHTPMG
KKPRRPNAKSAIPTSLPNLAKEAKEAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPNPMLATAAPSAQVHAQHALSFSNLHEMQPLAHGGASTVLP
SVSQLLSHHHIVPPGSGSAGSLGRLHPVTVPADWMNRVEVNDTQYNEMFGMVLAPAEGTH
PGMAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPTGAPQTQSSCPPAVAGPLPTM
YQIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSSAAE
RTPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHM
SEPPHSNMQVYA
Download sequence
Identical sequences G1TVK1
ENSOCUP00000021086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]