SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021166 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000021166
Domain Number - Region: 78-115
Classification Level Classification E-value
Superfamily SET domain 0.000101
Family Viral histone H3 Lysine 27 Methyltransferase 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021166   Gene: ENSOCUG00000006830   Transcript: ENSOCUT00000006831
Sequence length 143
Comment pep:novel chromosome:OryCun2.0:14:64283557:64284385:-1 gene:ENSOCUG00000006830 transcript:ENSOCUT00000006831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISRNLQSSYLFTGNECVYSNSPEIPLEEMPDADGVGSTASRNIQEPRSPATSSDAFTPTE
GSPYKAPIYIPDDIPIPADFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSDLKDP
SYGWEVRHMKDRRKTFAHYFFFL
Download sequence
Identical sequences G1TVS7
9986.ENSOCUP00000021166 ENSOCUP00000021166 ENSOCUP00000021166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]