SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021430 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021430
Domain Number 1 Region: 65-108
Classification Level Classification E-value
Superfamily TNF receptor-like 2.83e-16
Family BAFF receptor-like 0.00086
Further Details:      
 
Domain Number 2 Region: 32-68
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000259
Family BAFF receptor-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021430   Gene: ENSOCUG00000021728   Transcript: ENSOCUT00000032032
Sequence length 281
Comment pep:known_by_projection scaffold:OryCun2.0:GL019019:225100:234120:-1 gene:ENSOCUG00000021728 transcript:ENSOCUT00000032032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRAVSRARQGTAGVRGGGDAQTPQGPWTGLAMSSCPEEQFWDPLLNTCVSCKPMCSHRSQ
RTCAAFCKSLSCHKEPGRYYDPLLRDCVSCVSVCGQHPKPCAHFCDGRIRGRGGLSPELR
QQQDGESEARADSTGRYQGSEHRGLEAAPAPLVPRLSAHQLALVYSTLGVCLCAIICCFL
VAVACFLKRRGDQVSCQPPAGRPRAKPSQALPDPAMEAGPATCAPPGPVETCSFCFPERR
APTQESSATPETPRPTGSGLEGGHRQGVELGASPAMGEPGL
Download sequence
Identical sequences G1TWI4
9986.ENSOCUP00000021430 ENSOCUP00000021430 ENSOCUP00000021430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]