SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021461 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021461
Domain Number 1 Region: 26-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000208
Family V set domains (antibody variable domain-like) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021461   Gene: ENSOCUG00000023065   Transcript: ENSOCUT00000021615
Sequence length 224
Comment pep:novel scaffold:OryCun2.0:GL018989:264562:269084:1 gene:ENSOCUG00000023065 transcript:ENSOCUT00000021615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPSRRRAVWLSPPLLLLLIQGCFCLSGPSTVSGTEGGSLSVQCRYQEELRMRAKFWCSHP
CLPAQEIVKTKLPEEEARSGRVSIRDHPANLTFTVTLENLSIQDAGTYQCGVNEPWKWDI
FFLVMVLVSPETAPESGCSPGQGVGSYGGPTIPAMTLPAHTGEKPPEPSPHPGSLLGSVH
GLLLVFLKLPLLLAMLAAVLWVNRPQRGPGRGQTPWPWPCFAVL
Download sequence
Identical sequences G1TWL5
9986.ENSOCUP00000021461 ENSOCUP00000018171 ENSOCUP00000021461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]