SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021586 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021586
Domain Number 1 Region: 141-459
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.4e-124
Family Transglutaminase core 0.00000000449
Further Details:      
 
Domain Number 2 Region: 492-603
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.41e-26
Family Transglutaminase, two C-terminal domains 0.00028
Further Details:      
 
Domain Number 3 Region: 3-118
Classification Level Classification E-value
Superfamily E set domains 7.35e-26
Family Transglutaminase N-terminal domain 0.00057
Further Details:      
 
Domain Number 4 Region: 606-701
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 5.23e-24
Family Transglutaminase, two C-terminal domains 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021586   Gene: ENSOCUG00000014031   Transcript: ENSOCUT00000028053
Sequence length 704
Comment pep:known_by_projection chromosome:OryCun2.0:4:9531658:9553005:1 gene:ENSOCUG00000014031 transcript:ENSOCUT00000028053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGVRVTKVDWQRPRNGAAHRTEEYPCPELVIRRGQVFGLTLEVSGDPDSDENFIFTSPPG
PRASEAFHTKAEFETSELQVSAAWTAVKEAQTESTVAVSLSSPPDAAIGRYLLSARAXXX
XXXXXXXPSPTPGSDGCFSEDDVFLDSEEERQEYVLNDSGVIFRGVEKHIRAQGWNFGQF
EEDILSICLAILDRSPSHQAYPATDVCRRCDPVYVTRVISAMVNSNNDRGVVQGQWQGKY
GGGTSPLHWSGSVAILQKWFKGRFKPVKYGQCWVFAGVMCTVLRCLGIATRIVSNFNSAH
DTDRNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARPDLGPAYNGWQVLDATPQEE
SEGVFQCGPASVTAIREGDVHLAHDGPFVFAEVNADYVIWLWHEDESRERVYSDTKKIGR
CISTKAVGSDSRVDITGLYKYPEGSRKERQVYGKAVRKLFGAEARGKRARARRNAGRALW
RDALLEPAPSPSITGKFKALEPPVLGHDLKLALCLTNLTARAQRVQVNVSAATILYTRKP
VAEILQESHVVRLGPQEEKKIPIVIAYSQYKEDLTEDKKILLAAMCLVAKGEKLLVEKDI
TLEDFITIKVRGPAVVGVAVVVEVTVVNPLWERVEDCVLMVEGSGLLRGQLSIDVPALEP
QEKASVRFSITPSRSGPRQLQVDLVSAHFADIKGFAVIHVAAAK
Download sequence
Identical sequences G1TWY7
ENSOCUP00000021586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]