SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000021636 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000021636
Domain Number 1 Region: 523-553,660-736
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000455
Family Anti-sigma factor antagonist SpoIIaa 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000021636   Gene: ENSOCUG00000022624   Transcript: ENSOCUT00000025360
Sequence length 791
Comment pep:known_by_projection chromosome:OryCun2.0:16:66322764:66343618:1 gene:ENSOCUG00000022624 transcript:ENSOCUT00000025360 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQPRPRYAVDRAAYSLTLLDDEFEKKDRTYPVGEKLRNAFRCSPAKFKSLLFGLLPVLS
WIPKYKIKDYLVPDVLGGLSGGCIQVPQGMAFALLANLPPVNGLYSSFFPLLPYFFLGGI
HQMVPGTFAVISILVGNVCLQLAPESKFQVFNNATNETYVDTAAMEAARLRVSATLACLT
AVIQMGLGFMQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGLTITSYSGPGSIVFT
FIDICKKLPDTNIASLIFALVSGVVLTVVKELNARYMHKIHFPIPTEVVVVVIATAISGS
FKMPQKYNMQIVGEIQLGFPAPVLPVVSQWKEMFGTAFSLAIVSYVINLAMGRTLANKHG
YNIDPNQEIIALGCSNFFGSFFKIHVICCALSVTLSVDAAGGRSQIASLCVSLVVMVTML
VLGSYLYSLPKSVLGALISVNLKNSLKQLADPYYLWKKNKLDCCVWVVSFLSSFFLSLPY
GVAVGVTFSVLVVVFQTQFRNGHALAQVVDTDIYVNPKAYSRVQEIEGIKIVTYCSPLYF
ANSEIFRQKIISKTGMDPQKVLLAKQKQLRKQEKMRTMPTQQRDSLFMKTKTVSLQELQQ
DFETPSPTDPNNNQTPANGASISYINFSPATPSAAQGEPPAPAEPLSEPDATLASVPPFI
TFHTLILDLSGVSFVDLMGIKALAKLSSTYEKIGVRVFLVNIHAQVYNDLSHGGVFDDGC
LKRHHIFPSTHDAVLFAQADAREAAPGHSFPGVPEDNEHSLCNSEEESPSYWDLEQEMFG
SMFHTETLTAL
Download sequence
Identical sequences G1TX36
XP_008266728.1.1745 ENSOCUP00000021636 ENSOCUP00000021636 9986.ENSOCUP00000021636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]