SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022154 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022154
Domain Number 1 Region: 35-72
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 75-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 3 Region: 1-30
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000124
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022154   Gene: ENSOCUG00000026068   Transcript: ENSOCUT00000030759
Sequence length 310
Comment pep:known_by_projection chromosome:OryCun2.0:1:175326334:175506031:1 gene:ENSOCUG00000026068 transcript:ENSOCUT00000030759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSNGRCIPGAWQCDGLPDCFDKSDEKECPKAKSKCGPTFFPCASGIHCIIGRFRCNGFE
DCPDGSDEENCTANPLLCSTARYHCKNGLCIDKSFICDGQNNCQDNSDEESCESSQEPGS
GQVFVTSENQLVYYPSITYAIIGSSVIFVLVVALLALVLHHQRKRNNLMTLPVHRLQHPV
LLSRLVVLDHPHHCNVTYNVNNGIQYVASQAEQNASEVGSPPSYSEALLDQRPAWYDLPP
PPYSSDTESLNQADLPPYRSRSGSADSASSQATSSLLSVDDTGHSPGQPGPPEDTPQSRD
AVPSQGTEDV
Download sequence
Identical sequences G1TYJ0
ENSOCUP00000022154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]