SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022447 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022447
Domain Number 1 Region: 538-667
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000106
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022447   Gene: ENSOCUG00000021988   Transcript: ENSOCUT00000029486
Sequence length 683
Comment pep:known_by_projection scaffold:OryCun2.0:GL018714:756802:763802:1 gene:ENSOCUG00000021988 transcript:ENSOCUT00000029486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPRGARTRPGLGETSDLKYPLGTRLREPLTEVRFQQLFGGAEQEPELPAESFLPRFWR
LRARACSGRGAWRLLQARLPPLRWLPSYRWRAWLLGDAVAGVTVGVVHVPQGMAFALLTS
VPPVFGLYTSFFPVLIYSLLGTGRHLSTGTFAVLSLMTGSVVERLVPEPLAGNLSAVERE
QLDDQRVGAASALAFGSGALMLAMFALQLGVLATFLSEPVVKALTSGAAMHVLVSQLPSL
LGLSLPRQIGCFSLFKTLAAVLMALPRSSPAELIISALSLALLVPVKELNVRFRDRLPTP
IPGEVVMVLLATVLCFTSSLDTRYNVQIVGLLPQGFPQPHFPNLAELPRTLANSLPIALV
TFAVSASLASIYADKYCYTIDSNQELLAHGVSNLISSLFSCFPNSATLATTSLHVDAGGN
TQLAGLFSCTVVLSVLLWLGPFFYYLPKAVLACINISSMRQMFFQMHELPQLWRISRVDF
AVWMVTWVAVVTLSVELGLAVGVVFSMMTVVCRTQRVQCLALGHAAGTELYRPLRDSHEL
LQVPGLCILSCPMPLYFGTRGQFRRSLECHLGLAEKGQDTPKPEGPPDTVAEPVRVVILD
FSGVTFADAAGAREVAQLARRCQDAGIHLLLAQCNASVLGTLTRAGLLDTVTPEQLFVSV
QDAAAHALERLELTGPKICTVWL
Download sequence
Identical sequences G1TZC5
ENSOCUP00000022447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]