SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000022733 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000022733
Domain Number 1 Region: 7-96
Classification Level Classification E-value
Superfamily Histone-fold 1.96e-28
Family Nucleosome core histones 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000022733   Gene: ENSOCUG00000024947   Transcript: ENSOCUT00000027076
Sequence length 113
Comment pep:novel scaffold:OryCun2.0:GL018783:472925:473263:-1 gene:ENSOCUG00000024947 transcript:ENSOCUT00000027076 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSDSRRGSSHRRRRARSRTARAQLTFSVSQVERRLRQGHYAQRLSSSASVFLAATIEF
LTAKVLELAGNEAHNIGSRRITPHLVDMAVHNHGLLSGFFGTATISQVAPGRG
Download sequence
Identical sequences G1U055
ENSOCUP00000022733 9986.ENSOCUP00000022733 ENSOCUP00000022733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]