SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023080 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023080
Domain Number 1 Region: 137-212
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.0000000000000012
Family Ribosomal protein L14e 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023080   Gene: ENSOCUG00000023900   Transcript: ENSOCUT00000003653
Sequence length 275
Comment pep:novel chromosome:OryCun2.0:2:135618975:135619831:-1 gene:ENSOCUG00000023900 transcript:ENSOCUT00000003653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAGEKAPAPKPDTKKNPPAKKAGNASGKARKKNLKDERPEGEAPPQPKPCPAEGTGRHSQ
TARYSGKALHKRKHVAPKSRIEEEKVLVSVTKPVGGDKNGGTRVVKLHKMPYCPTKDVPR
KLLSHGKKPVSQHHPRTILVILTGRHRGKRAVFLKQLSSGLLLVTGPLSLNVPLCRTHQK
FVITTSTKIDISGVKPTHLTDAYLRKQQLWKPRHQEDEVFDTEKEKYEITEQHKVDQKAV
DSQILPKIKAAPQLQGYLRSVFALTDGIYPHKLVF
Download sequence
Identical sequences G1U147
ENSOCUP00000023080 9986.ENSOCUP00000023080 ENSOCUP00000023080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]