SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023495 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023495
Domain Number 1 Region: 206-296
Classification Level Classification E-value
Superfamily PKD domain 0.000000000183
Family PKD domain 0.0096
Further Details:      
 
Domain Number 2 Region: 307-343
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000038
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023495   Gene: ENSOCUG00000000502   Transcript: ENSOCUT00000024723
Sequence length 477
Comment pep:known_by_projection scaffold:OryCun2.0:GL018800:61076:107084:1 gene:ENSOCUG00000000502 transcript:ENSOCUT00000024723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFAAREGACSWRRLPTRNRVLRGLQLLCLRMVRERADGTSETPRSDLQAMLSGVEQLLE
EFCQELQLERPQEELELELPRRAAAPGRAARARVAAATVPCRTPSSAPRTPSRRAPASLS
APATVRDWRQCVAACCSEPRCSVAVVELPRRPAPPAAALGCYLFNCTVRGRSVCKFALHR
GYSSYSLSRVAAPDAAWASPGPEKDEPPQSKAGQNVVLHLPTDEVTLDGRESTDDHAIVQ
YEWTLLQGDPAVDMKVPQSGTLKLAHLQEGTYTFQLTVTDTAGQRASDNVSVTVLPMAHS
TEGCLGACSRYHFFCDDGCCIDITLACDGVQQCPDGSDEAFCQNLGLDRKMVTHAATSPA
QPRTTALSEDTGGVSLLEKSQEATAADQPAPLANPEKRNHSASAGTGSQVVPVMPDRSSS
GKKRKEENYIFESKSSRGEHPAPETERLSAAVESISLHPNSRGENPPPGSTLLLPCG
Download sequence
Identical sequences G1U299
ENSOCUP00000023495

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]