SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000023509 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000023509
Domain Number 1 Region: 2-274
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.01e-100
Family Inorganic pyrophosphatase 0.000000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000023509   Gene: ENSOCUG00000024724   Transcript: ENSOCUT00000023971
Sequence length 277
Comment pep:novel chromosome:OryCun2.0:1:77343691:77344569:-1 gene:ENSOCUG00000024724 transcript:ENSOCUT00000023971 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSEDYCLFFKNVAGHYIFPFHDIPLKVESKENLFNMVVEVPRWTNAKMEIATKEPLNPVK
QDVKHGKLRYVANIFPHKGYIWNYGALPQTWEDPHQTDESTNCCGDNDPIDVCKIGSKVL
TRGEVVHVKILGILARIDEGEMDWKLIAINANDPEASKFDDIDDVKKFKSGYLEATLTWF
KFYKVPDGIPENQFAFNGQFRNKAFALEVIKSTHDHWKALLMKKCDGGAINCTNVQVCDS
PFLCTQEEARSFIESKLSSSQNNENDEEEQIWHFLGK
Download sequence
Identical sequences G1U2B1
ENSOCUP00000023509 9986.ENSOCUP00000023509 ENSOCUP00000023509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]